UniProt ID | GNPI2_HUMAN | |
---|---|---|
UniProt AC | Q8TDQ7 | |
Protein Name | Glucosamine-6-phosphate isomerase 2 | |
Gene Name | GNPDA2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 276 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | ||
Protein Sequence | MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
28 | Ubiquitination | CNRIIQFKPGQDRYF HHHHCEECCCCCCEE | 31.68 | 21906983 | |
28 (in isoform 3) | Ubiquitination | - | 31.68 | 21890473 | |
28 (in isoform 2) | Ubiquitination | - | 31.68 | 21890473 | |
28 (in isoform 1) | Ubiquitination | - | 31.68 | 21890473 | |
36 | Phosphorylation | PGQDRYFTLGLPTGS CCCCCEEEECCCCCC | 15.81 | 25072903 | |
41 | Phosphorylation | YFTLGLPTGSTPLGC EEEECCCCCCCCCHH | 49.13 | 25072903 | |
43 | Phosphorylation | TLGLPTGSTPLGCYK EECCCCCCCCCHHHH | 29.36 | 25072903 | |
44 | Phosphorylation | LGLPTGSTPLGCYKK ECCCCCCCCCHHHHH | 24.71 | 25072903 | |
49 | Phosphorylation | GSTPLGCYKKLIEYH CCCCCHHHHHHHHHH | 14.90 | 25072903 | |
50 | Acetylation | STPLGCYKKLIEYHK CCCCHHHHHHHHHHH | 45.22 | 11924457 | |
50 (in isoform 3) | Ubiquitination | - | 45.22 | 21890473 | |
50 (in isoform 2) | Ubiquitination | - | 45.22 | 21890473 | |
50 (in isoform 1) | Ubiquitination | - | 45.22 | 21890473 | |
50 | Ubiquitination | STPLGCYKKLIEYHK CCCCHHHHHHHHHHH | 45.22 | 21890473 | |
50 | Ubiquitination | STPLGCYKKLIEYHK CCCCHHHHHHHHHHH | 45.22 | 21890473 | |
50 | Ubiquitination | STPLGCYKKLIEYHK CCCCHHHHHHHHHHH | 45.22 | - | |
51 | Acetylation | TPLGCYKKLIEYHKN CCCHHHHHHHHHHHC | 28.37 | 10985217 | |
51 | Ubiquitination | TPLGCYKKLIEYHKN CCCHHHHHHHHHHHC | 28.37 | - | |
62 | Phosphorylation | YHKNGHLSFKYVKTF HHHCCCEEEEEEEEE | 17.64 | 24719451 | |
64 | Ubiquitination | KNGHLSFKYVKTFNM HCCCEEEEEEEEECH | 45.84 | - | |
64 | Acetylation | KNGHLSFKYVKTFNM HCCCEEEEEEEEECH | 45.84 | - | |
67 (in isoform 1) | Ubiquitination | - | 44.29 | 21890473 | |
67 (in isoform 2) | Ubiquitination | - | 44.29 | 21890473 | |
67 | Ubiquitination | HLSFKYVKTFNMDEY CEEEEEEEEECHHHC | 44.29 | 21890473 | |
67 | Ubiquitination | HLSFKYVKTFNMDEY CEEEEEEEEECHHHC | 44.29 | 21890473 | |
67 | Ubiquitination | HLSFKYVKTFNMDEY CEEEEEEEEECHHHC | 44.29 | - | |
67 (in isoform 3) | Ubiquitination | - | 44.29 | 21890473 | |
68 | Phosphorylation | LSFKYVKTFNMDEYV EEEEEEEEECHHHCC | 15.36 | - | |
71 | Sulfoxidation | KYVKTFNMDEYVGLP EEEEEECHHHCCCCC | 3.46 | 31801345 | |
74 | Phosphorylation | KTFNMDEYVGLPRNH EEECHHHCCCCCCCC | 8.78 | - | |
124 | Ubiquitination | ECDAFENKIKEAGGI HHHHHHHHHHHHCCC | 48.21 | - | |
126 | Ubiquitination | DAFENKIKEAGGIDL HHHHHHHHHHCCCCE | 43.02 | - | |
151 | Phosphorylation | IAFNEPGSSLVSRTR EECCCCCCCHHCHHH | 31.08 | 23879269 | |
152 | Phosphorylation | AFNEPGSSLVSRTRL ECCCCCCCHHCHHHH | 38.41 | 23879269 | |
155 | Phosphorylation | EPGSSLVSRTRLKTL CCCCCHHCHHHHHHH | 32.97 | 23879269 | |
157 | Phosphorylation | GSSLVSRTRLKTLAM CCCHHCHHHHHHHHH | 32.61 | 23879269 | |
160 (in isoform 3) | Ubiquitination | - | 37.90 | 21890473 | |
160 (in isoform 1) | Ubiquitination | - | 37.90 | 21890473 | |
160 (in isoform 2) | Ubiquitination | - | 37.90 | 21890473 | |
160 | Ubiquitination | LVSRTRLKTLAMDTI HHCHHHHHHHHHHHH | 37.90 | 21906983 | |
161 | Phosphorylation | VSRTRLKTLAMDTIL HCHHHHHHHHHHHHH | 25.09 | 28348404 | |
164 | Sulfoxidation | TRLKTLAMDTILANA HHHHHHHHHHHHHCC | 5.41 | 21406390 | |
172 | Ubiquitination | DTILANAKYFDGDLS HHHHHCCCCCCCCHH | 46.38 | 21890473 | |
172 (in isoform 3) | Ubiquitination | - | 46.38 | 21890473 | |
172 (in isoform 1) | Ubiquitination | - | 46.38 | 21890473 | |
172 | Methylation | DTILANAKYFDGDLS HHHHHCCCCCCCCHH | 46.38 | - | |
172 | Ubiquitination | DTILANAKYFDGDLS HHHHHCCCCCCCCHH | 46.38 | 21890473 | |
172 | "N6,N6-dimethyllysine" | DTILANAKYFDGDLS HHHHHCCCCCCCCHH | 46.38 | - | |
172 (in isoform 2) | Ubiquitination | - | 46.38 | 21890473 | |
172 | Ubiquitination | DTILANAKYFDGDLS HHHHHCCCCCCCCHH | 46.38 | 21890473 | |
183 | Phosphorylation | GDLSKVPTMALTVGV CCHHHCCCEEEEECC | 20.33 | 22210691 | |
187 | Phosphorylation | KVPTMALTVGVGTVM HCCCEEEEECCCCEE | 12.99 | 20068231 | |
192 | Phosphorylation | ALTVGVGTVMDAREV EEEECCCCEECHHHH | 15.39 | 22210691 | |
213 (in isoform 2) | Phosphorylation | - | 8.57 | 22210691 | |
226 (in isoform 2) | Phosphorylation | - | 1.99 | 22210691 | |
243 (in isoform 2) | Phosphorylation | - | 16.43 | 22210691 | |
251 | Phosphorylation | TLELRVKTVKYFKGL CEEEEHHHHHHHCHH | 21.26 | - | |
253 | Ubiquitination | ELRVKTVKYFKGLMH EEEHHHHHHHCHHHH | 50.64 | - | |
254 | Phosphorylation | LRVKTVKYFKGLMHV EEHHHHHHHCHHHHH | 13.24 | 28509920 | |
259 | Sulfoxidation | VKYFKGLMHVHNKLV HHHHCHHHHHHHHHH | 4.18 | 30846556 | |
271 | Phosphorylation | KLVDPLFSMKDGN-- HHHCCHHCCCCCC-- | 32.38 | 24719451 | |
272 (in isoform 2) | Ubiquitination | - | 3.43 | 21890473 | |
273 (in isoform 1) | Ubiquitination | - | 62.38 | 21890473 | |
273 | Ubiquitination | VDPLFSMKDGN---- HCCHHCCCCCC---- | 62.38 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GNPI2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GNPI2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GNPI2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NOL3_HUMAN | NOL3 | physical | 22863883 | |
MTND_HUMAN | ADI1 | physical | 26344197 | |
CK054_HUMAN | C11orf54 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...