MTND_HUMAN - dbPTM
MTND_HUMAN - PTM Information in dbPTM
Basic Information of Protein
UniProt ID MTND_HUMAN
UniProt AC Q9BV57
Protein Name 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase {ECO:0000255|HAMAP-Rule:MF_03154}
Gene Name ADI1 {ECO:0000255|HAMAP-Rule:MF_03154}
Organism Homo sapiens (Human).
Sequence Length 179
Subcellular Localization Cytoplasm. Nucleus. Cell membrane
Peripheral membrane protein
Cytoplasmic side. Localizes to the plasma membrane when complexed to MMP14.
Protein Description Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene). Also down-regulates cell migration mediated by MMP14. Necessary for hepatitis C virus replication in an otherwise non-permissive cell line..
Protein Sequence MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster
6Phosphorylation--MVQAWYMDDAPGD
--CCCEEECCCCCCC
8.1527642862
7Sulfoxidation-MVQAWYMDDAPGDP
-CCCEEECCCCCCCC
2.3430846556
32MethylationPVGLEQLRRLGVLYW
CCCHHHHHHHCCEEE
31.32-
38PhosphorylationLRRLGVLYWKLDADK
HHHHCCEEEEECHHH
9.7029496907
39UbiquitinationRRLGVLYWKLDADKY
HHHCCEEEEECHHHC
7.2022505724
40UbiquitinationRLGVLYWKLDADKYE
HHCCEEEEECHHHCC
23.9622505724
45AcetylationYWKLDADKYENDPEL
EEEECHHHCCCCHHH
57.0725953088
45UbiquitinationYWKLDADKYENDPEL
EEEECHHHCCCCHHH
57.0722505724
46PhosphorylationWKLDADKYENDPELE
EEECHHHCCCCHHHH
22.101951789
54UbiquitinationENDPELEKIRRERNY
CCCHHHHHHHHHHCC
54.8833845483
61PhosphorylationKIRRERNYSWMDIIT
HHHHHHCCCHHHHHH
15.2127642862
67UbiquitinationNYSWMDIITICKDKL
CCCHHHHHHHHHHCC
1.5329967540
73AcetylationIITICKDKLPNYEEK
HHHHHHHCCCCHHHH
51.8723749302
73UbiquitinationIITICKDKLPNYEEK
HHHHHHHCCCCHHHH
51.8729967540
74UbiquitinationITICKDKLPNYEEKI
HHHHHHCCCCHHHHH
4.8222505724
80AcetylationKLPNYEEKIKMFYEE
CCCCHHHHHHHHHHH
35.3725953088
80UbiquitinationKLPNYEEKIKMFYEE
CCCCHHHHHHHHHHH
35.3722505724
85PhosphorylationEEKIKMFYEEHLHLD
HHHHHHHHHHHCCCC
19.5327642862
102PhosphorylationIRYILDGSGYFDVRD
CCHHHCCCCCEECCC
29.9546159817
104UbiquitinationYILDGSGYFDVRDKE
HHHCCCCCEECCCCC
9.7829967540
104PhosphorylationYILDGSGYFDVRDKE
HHHCCCCCEECCCCC
9.7846159823
110UbiquitinationGYFDVRDKEDQWIRI
CCEECCCCCCCEEEE
53.2629967540
115UbiquitinationRDKEDQWIRIFMEKG
CCCCCCEEEEEEECC
1.6921963094
121UbiquitinationWIRIFMEKGDMVTLP
EEEEEEECCCEEEEE
48.7121963094
124SulfoxidationIFMEKGDMVTLPAGI
EEEECCCEEEEECCE
3.1930846556
132PhosphorylationVTLPAGIYHRFTVDE
EEEECCEEEEEECCC
5.9927642862
134UbiquitinationLPAGIYHRFTVDEKN
EECCEEEEEECCCCC
16.3824816145
140UbiquitinationHRFTVDEKNYTKAMR
EEEECCCCCCHHHHH
51.2824816145
142PhosphorylationFTVDEKNYTKAMRLF
EECCCCCCHHHHHHH
22.2329496907
143PhosphorylationTVDEKNYTKAMRLFV
ECCCCCCHHHHHHHC
23.0129496907
144UbiquitinationVDEKNYTKAMRLFVG
CCCCCCHHHHHHHCC
29.80-
156PhosphorylationFVGEPVWTAYNRPAD
HCCCCEEHHCCCCCC
21.3528796482
158PhosphorylationGEPVWTAYNRPADHF
CCCEEHHCCCCCCHH
12.3428796482
167UbiquitinationRPADHFEARGQYVKF
CCCCHHHHHHHHHHH
21.6922505724
173UbiquitinationEARGQYVKFLAQTA-
HHHHHHHHHHHHCC-
29.7122505724

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of MTND_HUMAN !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of MTND_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of MTND_HUMAN !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions
ODB2_HUMANDBTphysical
17353931
A4_HUMANAPPphysical
21832049
ALDOA_HUMANALDOAphysical
26344197
ALDOC_HUMANALDOCphysical
26344197
GLGB_HUMANGBE1physical
26344197
NIT1_HUMANNIT1physical
26344197
PGK1_HUMANPGK1physical
26344197

Drug and Disease Associations
Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of MTND_HUMAN

loading...

Related Literatures of Post-Translational Modification

TOP