UniProt ID | PAU1_YEAST | |
---|---|---|
UniProt AC | P0CE88 | |
Protein Name | Seripauperin-1 | |
Gene Name | PAU1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 120 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MVKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVAEAVFNYGDFTTMLTGISPDQVTRMITGVPWYSSRLKPAISSALSKDGIYTIAN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of PAU1_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAU1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAU1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAU1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SMD1_YEAST | SMD1 | genetic | 27708008 | |
TFC3_YEAST | TFC3 | genetic | 27708008 | |
CDC48_YEAST | CDC48 | genetic | 27708008 | |
TCPD_YEAST | CCT4 | genetic | 27708008 | |
RPN5_YEAST | RPN5 | genetic | 27708008 | |
LCB2_YEAST | LCB2 | genetic | 27708008 | |
TCPA_YEAST | TCP1 | genetic | 27708008 | |
DPOD2_YEAST | POL31 | genetic | 27708008 | |
CDC11_YEAST | CDC11 | genetic | 27708008 | |
POB3_YEAST | POB3 | genetic | 27708008 | |
NUF2_YEAST | NUF2 | genetic | 27708008 | |
HRP1_YEAST | HRP1 | genetic | 27708008 | |
RPB2_YEAST | RPB2 | genetic | 27708008 | |
MED4_YEAST | MED4 | genetic | 27708008 | |
APC5_YEAST | APC5 | genetic | 27708008 | |
SYA_YEAST | ALA1 | genetic | 27708008 | |
SEC62_YEAST | SEC62 | genetic | 27708008 | |
NAB3_YEAST | NAB3 | genetic | 27708008 | |
STE50_YEAST | STE50 | genetic | 27708008 | |
THRC_YEAST | THR4 | genetic | 27708008 | |
MTU1_YEAST | SLM3 | genetic | 27708008 | |
ATG1_YEAST | ATG1 | genetic | 27708008 | |
RTF1_YEAST | RTF1 | genetic | 27708008 | |
PTK2_YEAST | PTK2 | genetic | 27708008 | |
CSF1_YEAST | CSF1 | genetic | 27708008 | |
MGR3_YEAST | MGR3 | genetic | 27708008 | |
EOS1_YEAST | EOS1 | genetic | 27708008 | |
RCF2_YEAST | RCF2 | genetic | 27708008 | |
SYC1_YEAST | SYC1 | genetic | 27708008 | |
UIP4_YEAST | UIP4 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...