| UniProt ID | PAU1_YEAST | |
|---|---|---|
| UniProt AC | P0CE88 | |
| Protein Name | Seripauperin-1 | |
| Gene Name | PAU1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 120 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MVKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVAEAVFNYGDFTTMLTGISPDQVTRMITGVPWYSSRLKPAISSALSKDGIYTIAN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of PAU1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAU1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAU1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAU1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SMD1_YEAST | SMD1 | genetic | 27708008 | |
| TFC3_YEAST | TFC3 | genetic | 27708008 | |
| CDC48_YEAST | CDC48 | genetic | 27708008 | |
| TCPD_YEAST | CCT4 | genetic | 27708008 | |
| RPN5_YEAST | RPN5 | genetic | 27708008 | |
| LCB2_YEAST | LCB2 | genetic | 27708008 | |
| TCPA_YEAST | TCP1 | genetic | 27708008 | |
| DPOD2_YEAST | POL31 | genetic | 27708008 | |
| CDC11_YEAST | CDC11 | genetic | 27708008 | |
| POB3_YEAST | POB3 | genetic | 27708008 | |
| NUF2_YEAST | NUF2 | genetic | 27708008 | |
| HRP1_YEAST | HRP1 | genetic | 27708008 | |
| RPB2_YEAST | RPB2 | genetic | 27708008 | |
| MED4_YEAST | MED4 | genetic | 27708008 | |
| APC5_YEAST | APC5 | genetic | 27708008 | |
| SYA_YEAST | ALA1 | genetic | 27708008 | |
| SEC62_YEAST | SEC62 | genetic | 27708008 | |
| NAB3_YEAST | NAB3 | genetic | 27708008 | |
| STE50_YEAST | STE50 | genetic | 27708008 | |
| THRC_YEAST | THR4 | genetic | 27708008 | |
| MTU1_YEAST | SLM3 | genetic | 27708008 | |
| ATG1_YEAST | ATG1 | genetic | 27708008 | |
| RTF1_YEAST | RTF1 | genetic | 27708008 | |
| PTK2_YEAST | PTK2 | genetic | 27708008 | |
| CSF1_YEAST | CSF1 | genetic | 27708008 | |
| MGR3_YEAST | MGR3 | genetic | 27708008 | |
| EOS1_YEAST | EOS1 | genetic | 27708008 | |
| RCF2_YEAST | RCF2 | genetic | 27708008 | |
| SYC1_YEAST | SYC1 | genetic | 27708008 | |
| UIP4_YEAST | UIP4 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...