UniProt ID | MLC1_DROME | |
---|---|---|
UniProt AC | P06742 | |
Protein Name | Myosin light chain alkali | |
Gene Name | Mlc1 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 155 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MADVPKREVENVEFVFEVMGSPGEGIDAVDLGDALRALNLNPTLALIEKLGGTKKRNEKKIKLDEFLPIYSQVKKEKEQGCYEDFIECLKLYDKEENGTMLLAELQHALLALGESLDDEQVETLFADCMDPEDDEGFIPYSQFVQRLMSDPVVFD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of MLC1_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MLC1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MLC1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MLC1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MK14B_DROME | p38b | physical | 14605208 | |
LIS1_DROME | Lis-1 | physical | 14605208 | |
MYSA_DROME | Mhc | physical | 22036573 | |
MLR_DROME | Mlc2 | physical | 22036573 | |
TPM2_DROME | Tm2 | physical | 22036573 | |
MYSP1_DROME | Prm | physical | 22036573 | |
MYSP2_DROME | Prm | physical | 22036573 | |
TNNT_DROME | up | physical | 22036573 | |
CUA1_DROME | Acp1 | physical | 22036573 | |
TNNI_DROME | wupA | physical | 22036573 | |
FTN_DROME | fln | physical | 22036573 | |
GSTS1_DROME | GstS1 | physical | 22036573 | |
TNNC1_DROME | TpnC41C | physical | 22036573 | |
ATP5J_DROME | ATPsyn-Cf6 | physical | 22036573 | |
AT5F1_DROME | ATPsyn-b | physical | 22036573 | |
OB56D_DROME | Obp56d | physical | 22036573 | |
VDAC_DROME | porin | physical | 22036573 | |
CISY_DROME | kdn | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...