| UniProt ID | MLC1_DROME | |
|---|---|---|
| UniProt AC | P06742 | |
| Protein Name | Myosin light chain alkali | |
| Gene Name | Mlc1 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 155 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MADVPKREVENVEFVFEVMGSPGEGIDAVDLGDALRALNLNPTLALIEKLGGTKKRNEKKIKLDEFLPIYSQVKKEKEQGCYEDFIECLKLYDKEENGTMLLAELQHALLALGESLDDEQVETLFADCMDPEDDEGFIPYSQFVQRLMSDPVVFD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of MLC1_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MLC1_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MLC1_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MLC1_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MK14B_DROME | p38b | physical | 14605208 | |
| LIS1_DROME | Lis-1 | physical | 14605208 | |
| MYSA_DROME | Mhc | physical | 22036573 | |
| MLR_DROME | Mlc2 | physical | 22036573 | |
| TPM2_DROME | Tm2 | physical | 22036573 | |
| MYSP1_DROME | Prm | physical | 22036573 | |
| MYSP2_DROME | Prm | physical | 22036573 | |
| TNNT_DROME | up | physical | 22036573 | |
| CUA1_DROME | Acp1 | physical | 22036573 | |
| TNNI_DROME | wupA | physical | 22036573 | |
| FTN_DROME | fln | physical | 22036573 | |
| GSTS1_DROME | GstS1 | physical | 22036573 | |
| TNNC1_DROME | TpnC41C | physical | 22036573 | |
| ATP5J_DROME | ATPsyn-Cf6 | physical | 22036573 | |
| AT5F1_DROME | ATPsyn-b | physical | 22036573 | |
| OB56D_DROME | Obp56d | physical | 22036573 | |
| VDAC_DROME | porin | physical | 22036573 | |
| CISY_DROME | kdn | physical | 22036573 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
