MEIS2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MEIS2_HUMAN
• UniProt AC: O14770
• Protein Name: Homeobox protein Meis2
• Gene Name: MEIS2
• Organism: Homo sapiens (Human).
• Sequence Length: 477
• Subcellular Localization: Nucleus . Cytoplasm, perinuclear region .
• Protein Description: Involved in transcriptional regulation. Binds to HOX or PBX proteins to form dimers, or to a DNA-bound dimer of PBX and HOX proteins and thought to have a role in stabilization of the homeoprotein-DNA complex. Isoform 3 is required for the activity of a PDX1:PBX1b:MEIS2b complex in pancreatic acinar cells involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element; MEIS2 is not involved in complex DNA-binding. Probably in complex with PBX1, is involved in transcriptional regulation by KLF4. Isoform 3 and isoform 4 can bind to a EPHA8 promoter sequence containing the DNA motif 5'-CGGTCA-3'; in cooperation with a PBX protein (such as PBX2) is proposed to be involved in the transcriptional activation of EPHA8 in the developing midbrain. May be involved in regulation of myeloid differentiation. Can bind to the DNA sequence 5'-TGACAG-3'in the activator ACT sequence of the D(1A) dopamine receptor (DRD1) promoter and activate DRD1 transcription; isoform 5 cannot activate DRD1 transcription..
• Protein Sequence: MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
138	Phosphorylation	RAEKPLFSSNPELDN HCCCCCCCCCHHHHH	36.57	27732954
139	Phosphorylation	AEKPLFSSNPELDNL CCCCCCCCCHHHHHH	49.41	27732954
180	Ubiquitination	HRYISCLKGKMPIDL HHHHHHHCCCCCEEE	61.89	-
195	Phosphorylation	VIDERDGSSKSDHEE EEECCCCCCCCCCCH	38.59	27794612
196	Phosphorylation	IDERDGSSKSDHEEL EECCCCCCCCCCCHH	41.53	27794612
198	Phosphorylation	ERDGSSKSDHEELSG CCCCCCCCCCCHHCC	46.26	22617229
204	Phosphorylation	KSDHEELSGSSTNLA CCCCCHHCCCCCCCC	39.65	23663014
206	Phosphorylation	DHEELSGSSTNLADH CCCHHCCCCCCCCCC	30.52	23663014
207	Phosphorylation	HEELSGSSTNLADHN CCHHCCCCCCCCCCC	25.49	23663014
208	Phosphorylation	EELSGSSTNLADHNP CHHCCCCCCCCCCCC	35.63	23663014
216	Phosphorylation	NLADHNPSSWRDHDD CCCCCCCCCCCCCCC	48.10	24117733
217	Phosphorylation	LADHNPSSWRDHDDA CCCCCCCCCCCCCCC	27.64	24117733

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MEIS2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MEIS2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MEIS2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PBX1_HUMAN	PBX1	physical	20211142
TRI25_HUMAN	TRIM25	physical	20211142
ZNHI3_HUMAN	ZNHIT3	physical	20211142
A4_HUMAN	APP	physical	21832049
MEIS2_HUMAN	MEIS2	physical	25416956
OSGI1_HUMAN	OSGIN1	physical	25416956
CA094_HUMAN	C1orf94	physical	25416956
MEIS3_HUMAN	MEIS3	physical	26186194
MEIS1_HUMAN	MEIS1	physical	26186194
PBX1_HUMAN	PBX1	physical	26186194
PBX2_HUMAN	PBX2	physical	26186194
PBX4_HUMAN	PBX4	physical	26186194
PBX3_HUMAN	PBX3	physical	26186194
GBB4_HUMAN	GNB4	physical	26186194
PIGL_HUMAN	PIGL	physical	26186194
MEIS3_HUMAN	MEIS3	physical	28514442
PBX2_HUMAN	PBX2	physical	28514442
PBX4_HUMAN	PBX4	physical	28514442
PBX3_HUMAN	PBX3	physical	28514442
PBX1_HUMAN	PBX1	physical	28514442
MEIS1_HUMAN	MEIS1	physical	28514442
PIGL_HUMAN	PIGL	physical	28514442
ACTB_HUMAN	ACTB	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.