UniProt ID | PIGL_HUMAN | |
---|---|---|
UniProt AC | Q9Y2B2 | |
Protein Name | N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase | |
Gene Name | PIGL | |
Organism | Homo sapiens (Human). | |
Sequence Length | 252 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein. |
|
Protein Description | Involved in the second step of GPI biosynthesis. De-N-acetylation of N-acetylglucosaminyl-phosphatidylinositol.. | |
Protein Sequence | MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHPDDEAMFFAPTVLGLARLRHWVYLLCFSAGNYYNQGETRKKELLQSCDVLGIPLSSVMIIDNRDFPDDPGMQWDTEHVARVLLQHIEVNGINLVVTFDAGGVSGHSNHIALYAAVRALHSEGKLPKGCSVLTLQSVNVLRKYISLLDLPLSLLHTQDVLFVLNSKEVAQAKKAMSCHRSQLLWFRRLYIIFSRYMRINSLSFL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 | Phosphorylation | GFLWVWDSSERMKSR HHHHHCCCCHHHHHH | 20.56 | 24043423 | |
25 | Phosphorylation | FLWVWDSSERMKSRE HHHHCCCCHHHHHHH | 27.09 | 24043423 | |
72 | Phosphorylation | ARLRHWVYLLCFSAG HHHHHHHHHHHHCCC | 6.70 | 26356563 | |
77 | Phosphorylation | WVYLLCFSAGNYYNQ HHHHHHHCCCCCCCC | 33.98 | 26356563 | |
81 | Phosphorylation | LCFSAGNYYNQGETR HHHCCCCCCCCCHHH | 11.68 | 26356563 | |
82 | Phosphorylation | CFSAGNYYNQGETRK HHCCCCCCCCCHHHH | 12.66 | 26356563 | |
104 | Phosphorylation | DVLGIPLSSVMIIDN CCCCCCHHHEEEECC | 18.61 | 22210691 | |
105 | Phosphorylation | VLGIPLSSVMIIDNR CCCCCHHHEEEECCC | 24.32 | 22210691 | |
124 | Phosphorylation | DPGMQWDTEHVARVL CCCCCCCHHHHHHHH | 25.65 | 29759185 | |
243 | Phosphorylation | LYIIFSRYMRINSLS HHHHHHHHHCHHHHC | 6.91 | 24719451 | |
248 | Phosphorylation | SRYMRINSLSFL--- HHHHCHHHHCCC--- | 24.02 | 24719451 | |
250 | Phosphorylation | YMRINSLSFL----- HHCHHHHCCC----- | 25.07 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PIGL_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PIGL_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIGL_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PIGL_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...