| UniProt ID | MEIS3_HUMAN | |
|---|---|---|
| UniProt AC | Q99687 | |
| Protein Name | Homeobox protein Meis3 | |
| Gene Name | MEIS3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 375 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcriptional regulator which directly modulates PDPK1 expression, thus promoting survival of pancreatic beta-cells. Also regulates expression of NDFIP1, BNIP3, and CCNG1.. | |
| Protein Sequence | MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 80 | Phosphorylation | FEKCELATCSPRDGA HHHCCCCCCCCCCCC | 26.58 | - | |
| 118 | Phosphorylation | AFAKQVRSERPLFSS HHHHHHHCCCCCCCC | 38.82 | - | |
| 124 | Phosphorylation | RSERPLFSSNPELDN HCCCCCCCCCHHHHH | 36.57 | - | |
| 328 | Phosphorylation | VQPMIDQSNRTGQGA HHCHHCCCCCCCCCC | 25.24 | 28555341 | |
| 331 | Phosphorylation | MIDQSNRTGQGAAFS HHCCCCCCCCCCCCC | 37.80 | 24275569 | |
| 338 | Phosphorylation | TGQGAAFSPEGQPIG CCCCCCCCCCCCCCC | 19.81 | 24275569 | |
| 347 | Phosphorylation | EGQPIGGYTETQPHV CCCCCCCCCCCCCEE | 9.01 | 24275569 | |
| 350 | Phosphorylation | PIGGYTETQPHVAVR CCCCCCCCCCEEEEC | 39.33 | 24275569 | |
| 365 | Phosphorylation | PPGSVGMSLNLEGEW CCCCCCEEEECCCCE | 14.26 | 24275569 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MEIS3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MEIS3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MEIS3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MEIS3_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
