UniProt ID | GEMI_MOUSE | |
---|---|---|
UniProt AC | O88513 | |
Protein Name | Geminin | |
Gene Name | Gmnn | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 206 | |
Subcellular Localization | Cytoplasm. Nucleus. Mainly cytoplasmic but can be relocalized to the nucleus.. | |
Protein Description | Inhibits DNA replication by preventing the incorporation of MCM complex into pre-replication complex (pre-RC). It is degraded during the mitotic phase of the cell cycle. Its destruction at the metaphase-anaphase transition permits replication in the succeeding cell cycle.; Inhibits the transcriptional activity of a subset of Hox proteins, enrolling them in cell proliferative control.. | |
Protein Sequence | MNLSMKQKQEGAQENVKNSPVPRRTLKMIQPSADGSLVGRENELPKGLFKRKLWDDQLASQTSSCGPEANENKDVGDLTQEAFDLISKENPSSQYWKEVAEQRRKALYEALKENEKLHKEIEQKDSEIARLRKENKDLAEVAEHVQYMAEVIERLSNEPLDNFESPDSQEFDSEEEAVEYSELEDSGAGTCAEETVSSSTDARPCT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Phosphorylation | AQENVKNSPVPRRTL HHHHHCCCCCCHHHH | 22.89 | 26824392 | |
27 | Acetylation | PVPRRTLKMIQPSAD CCCHHHHHHCCCCCC | 33.09 | - | |
36 | Phosphorylation | IQPSADGSLVGRENE CCCCCCCCCCCCCCC | 22.04 | - | |
63 | Phosphorylation | DQLASQTSSCGPEAN HHHHHCCCCCCCCCC | 18.92 | - | |
64 | Phosphorylation | QLASQTSSCGPEANE HHHHCCCCCCCCCCC | 26.87 | - | |
181 | Phosphorylation | EEEAVEYSELEDSGA HHHHHHHHHHCCCCC | 23.38 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
181 | S | Phosphorylation | Kinase | CK2 | - | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
181 | S | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GEMI_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SPA24_MOUSE | Spata24 | physical | 19515240 | |
TBP_MOUSE | Tbp | physical | 19515240 | |
TBPL1_MOUSE | Tbpl1 | physical | 19515240 | |
TF2B_MOUSE | Gtf2b | physical | 19515240 | |
HXA11_MOUSE | Hoxa11 | physical | 14973489 | |
HXD10_MOUSE | Hoxd10 | physical | 14973489 | |
SCMH1_MOUSE | Scmh1 | physical | 14973489 | |
HXA7_MOUSE | Hoxa7 | physical | 14973489 | |
HXB7_MOUSE | Hoxb7 | physical | 14973489 | |
HXC8_MOUSE | Hoxc8 | physical | 14973489 | |
HXC9_MOUSE | Hoxc9 | physical | 14973489 | |
HXA10_MOUSE | Hoxa10 | physical | 14973489 | |
PHC1_MOUSE | Phc1 | physical | 14973489 | |
CDT1_MOUSE | Cdt1 | physical | 14973489 | |
CDT1_MOUSE | Cdt1 | physical | 15286659 | |
SCMH1_MOUSE | Scmh1 | physical | 23207902 | |
CCNA2_HUMAN | CCNA2 | physical | 26496610 | |
CKS1_HUMAN | CKS1B | physical | 26496610 | |
SKP2_HUMAN | SKP2 | physical | 26496610 | |
CDT1_HUMAN | CDT1 | physical | 26496610 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...