HXC9_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HXC9_MOUSE
• UniProt AC: P09633
• Protein Name: Homeobox protein Hox-C9
• Gene Name: Hoxc9
• Organism: Mus musculus (Mouse).
• Sequence Length: 260
• Subcellular Localization: Nucleus.
• Protein Description: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis..
• Protein Sequence: MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPAVFSTSWAPVPSQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAYPGRRADCGPGDGRSYPDYMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
143	Phosphorylation	RSYPDYMYGSPGELR CCCCCHHCCCCCHHH	14.28	28066266
145	Phosphorylation	YPDYMYGSPGELRDR CCCHHCCCCCHHHCC	16.55	28066266
156	Phosphorylation	LRDRAPQTLPSPEAD HHCCCCCCCCCHHHH	39.31	27149854
159	Phosphorylation	RAPQTLPSPEADALA CCCCCCCCHHHHHHC	38.19	28066266

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HXC9_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HXC9_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HXC9_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of HXC9_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.