| UniProt ID | HXA10_MOUSE | |
|---|---|---|
| UniProt AC | P31310 | |
| Protein Name | Homeobox protein Hox-A10 | |
| Gene Name | Hoxa10 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 416 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds to the DNA sequence 5'-AA[AT]TTTTATTAC-3'.. | |
| Protein Sequence | MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGVGGGSAGGGGGGYYAHGGVYLPPASDLPYGLQSCGLFPALGSKRNEAPSPGGGGGGGSGGLGPGTHGYAPAPLDLWLDAPRSCRMEPPDGPPPPQPQPQQQQQQPPPPPPQPPQPQPQATSCSFAQNIKEESSYCLYDAADKCPKGSAAADLAPFPRGPPPDGCALGASSGVPVPGYFRLSQAYGTAKGFGSGGGGTQQLASPFPAQPPGRGFDPPPALASGSTEAAGKERVLDSTPPPTLVCTGGGGSQGDEEAHASSSAAEELSPAPSENSKASPEKDSLGSSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HXA10_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HXA10_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HXA10_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PBX1_MOUSE | Pbx1 | physical | 20211142 | |
| PBX2_MOUSE | Pbx2 | physical | 20211142 | |
| ELOB_MOUSE | Tceb2 | physical | 20211142 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...