dbPTM

HXA10_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HXA10_MOUSE
UniProt AC	P31310
Protein Name	Homeobox protein Hox-A10
Gene Name	Hoxa10
Organism	Mus musculus (Mouse).
Sequence Length	416
Subcellular Localization	Nucleus.
Protein Description	Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds to the DNA sequence 5'-AA[AT]TTTTATTAC-3'..
Protein Sequence	MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGVGGGSAGGGGGGYYAHGGVYLPPASDLPYGLQSCGLFPALGSKRNEAPSPGGGGGGGSGGLGPGTHGYAPAPLDLWLDAPRSCRMEPPDGPPPPQPQPQQQQQQPPPPPPQPPQPQPQATSCSFAQNIKEESSYCLYDAADKCPKGSAAADLAPFPRGPPPDGCALGASSGVPVPGYFRLSQAYGTAKGFGSGGGGTQQLASPFPAQPPGRGFDPPPALASGSTEAAGKERVLDSTPPPTLVCTGGGGSQGDEEAHASSSAAEELSPAPSENSKASPEKDSLGSSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
92	Phosphorylation	SKRNEAPSPGGGGGG CCCCCCCCCCCCCCC	43.13	19060867
245	Phosphorylation	GGTQQLASPFPAQPP CHHCCCCCCCCCCCC	35.35	23608596

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HXA10_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HXA10_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HXA10_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PBX1_MOUSE	Pbx1	physical	20211142
PBX2_MOUSE	Pbx2	physical	20211142
ELOB_MOUSE	Tceb2	physical	20211142

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HXA10_MOUSE

Related Literatures of Post-Translational Modification