| UniProt ID | PBX1_MOUSE | |
|---|---|---|
| UniProt AC | P41778 | |
| Protein Name | Pre-B-cell leukemia transcription factor 1 | |
| Gene Name | Pbx1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 430 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Plays a role in the cAMP-dependent regulation of CYP17 gene expression via its cAMP-regulatory sequence (CRS1) 5'-ATCAATCAA-3'. Acts as a transcriptional activator of PF4 in complex with MEIS1. May have a role in steroidogenesis and, subsequently, sexual development and differentiation. Isoform PBX1b as part of a PDX1:PBX1b:MEIS2b complex in pancreatic acinar cells is involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element. Probably in complex with MEIS2, is involved in transcriptional regulation by KLF4. Acts as a transcriptional activator of NKX2-5 and a transcriptional repressor of CDKN2B. Together with NKX2-5, it is required for spleen development through a mechanism that involves CDKN2B repression.. | |
| Protein Sequence | MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEGPGSVHSDTSN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 126 | Phosphorylation | GPEKGGGSAAAAAAA CCCCCCHHHHHHHHH | 20.29 | - | |
| 141 | Phosphorylation | AASGGAGSDNSVEHS HHHCCCCCCCCCCHH | 32.84 | 29514104 | |
| 193 | Phosphorylation | QSRTRPISPKEIERM HHCCCCCCHHHHHHH | 32.38 | 29514104 | |
| 209 | Phosphorylation | SIIHRKFSSIQMQLK HHHHHHHHHHHHHHH | 29.57 | 30635358 | |
| 210 | Phosphorylation | IIHRKFSSIQMQLKQ HHHHHHHHHHHHHHH | 21.70 | 30635358 | |
| 218 | Phosphorylation | IQMQLKQSTCEAVMI HHHHHHHCHHHHHHH | 33.18 | 30635358 | |
| 219 | Phosphorylation | QMQLKQSTCEAVMIL HHHHHHCHHHHHHHH | 16.33 | 30635358 | |
| 287 | Acetylation | VSNWFGNKRIRYKKN HHHHHCCCCEEEECC | 49.97 | 30987083 | |
| 309 (in isoform 2) | Phosphorylation | - | 22.95 | 26160508 | |
| 312 (in isoform 2) | Phosphorylation | - | 25.87 | 26160508 | |
| 314 (in isoform 2) | Phosphorylation | - | 27.13 | 26160508 | |
| 317 (in isoform 2) | Phosphorylation | - | 19.33 | 26160508 | |
| 321 (in isoform 2) | Phosphorylation | - | 19.09 | 26160508 | |
| 325 | Phosphorylation | AHGSQANSPSTPNSA CCCCCCCCCCCCCCC | 24.20 | - | |
| 325 (in isoform 2) | Phosphorylation | - | 24.20 | 26160508 | |
| 327 | Phosphorylation | GSQANSPSTPNSAGS CCCCCCCCCCCCCCC | 57.21 | - | |
| 327 (in isoform 2) | Phosphorylation | - | 57.21 | 26160508 | |
| 328 (in isoform 2) | Phosphorylation | - | 29.85 | 26160508 | |
| 331 (in isoform 2) | Phosphorylation | - | 34.90 | 26160508 | |
| 331 | Phosphorylation | NSPSTPNSAGSSSSF CCCCCCCCCCCCCCC | 34.90 | - | |
| 335 (in isoform 2) | Phosphorylation | - | 29.14 | 26160508 | |
| 337 (in isoform 2) | Phosphorylation | - | 23.69 | 26160508 | |
| 340 (in isoform 2) | Phosphorylation | - | 3.65 | 26160508 | |
| 423 | Phosphorylation | SPTEGPGSVHSDTSN CCCCCCCCCCCCCCC | 21.57 | 23684622 | |
| 426 | Phosphorylation | EGPGSVHSDTSN--- CCCCCCCCCCCC--- | 40.19 | 23684622 | |
| 428 | Phosphorylation | PGSVHSDTSN----- CCCCCCCCCC----- | 32.93 | 23684622 | |
| 429 | Phosphorylation | GSVHSDTSN------ CCCCCCCCC------ | 45.60 | 23684622 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PBX1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PBX1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PBX1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TCF21_MOUSE | Tcf21 | physical | 20211142 | |
| ZN593_MOUSE | Zfp593 | physical | 20211142 | |
| PKNX2_MOUSE | Pknox2 | physical | 20211142 | |
| MEIS1_MOUSE | Meis1 | physical | 9315626 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
