| UniProt ID | ZN593_MOUSE | |
|---|---|---|
| UniProt AC | Q9DB42 | |
| Protein Name | Zinc finger protein 593 | |
| Gene Name | Znf593 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 134 | |
| Subcellular Localization | Nucleus, nucleolus. | |
| Protein Description | Negatively modulates the DNA binding activity of Oct-2 and therefore its transcriptional regulatory activity. Could act either by binding to DNA octamer or by interacting with Oct-2. May also be a modulator of other octamer-binding proteins (By similarity).. | |
| Protein Sequence | MGRSRRTGAHRAHSLARQMKAKKRRPDLDEIHRELRPQGLPRPKPEPDAEPDPDLPGGGLHRCLACARYFIDSANLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVQPQRLGVPTEVSTDIPEMDTST | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 93 | Phosphorylation | KKRLKQLSVEPYSQE HHHHHHCCCCCCCHH | 23.18 | 30635358 | |
| 97 | Phosphorylation | KQLSVEPYSQEEAER HHCCCCCCCHHHHHH | 14.96 | 30635358 | |
| 98 | Phosphorylation | QLSVEPYSQEEAERA HCCCCCCCHHHHHHH | 41.66 | 30635358 | |
| 124 | Phosphorylation | LGVPTEVSTDIPEMD CCCCCCCCCCCCCCC | 17.71 | 23984901 | |
| 125 | Phosphorylation | GVPTEVSTDIPEMDT CCCCCCCCCCCCCCC | 43.02 | 23984901 | |
| 132 | Phosphorylation | TDIPEMDTST----- CCCCCCCCCC----- | 32.71 | 26643407 | |
| 133 | Phosphorylation | DIPEMDTST------ CCCCCCCCC------ | 28.05 | 29895711 | |
| 134 | Phosphorylation | IPEMDTST------- CCCCCCCC------- | 44.73 | 24453211 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN593_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN593_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN593_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ZN593_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
