dbPTM

ENOPH_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ENOPH_YEAST
UniProt AC	P32626
Protein Name	Enolase-phosphatase E1 {ECO:0000255\|HAMAP-Rule:MF_03117}
Gene Name	UTR4 {ECO:0000255\|HAMAP-Rule:MF_03117}
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	227
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene)..
Protein Sequence	MGDNYSTYLLDIEGTVCPISFVKETLFPYFTNKVPQLVQQDTRDSPVSNILSQFHIDNKEQLQAHILELVAKDVKDPILKQLQGYVWAHGYESGQIKAPVYADAIDFIKRKKRVFIYSSGSVKAQKLLFGYVQDPNAPAHDSLDLNSYIDGYFDINTSGKKTETQSYANILRDIGAKASEVLFLSDNPLELDAAAGVGIATGLASRPGNAPVPDGQKYQVYKNFETL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
33	Acetylation	LFPYFTNKVPQLVQQ HHHHHCCCCCHHHCC	52.84	24489116
42	Phosphorylation	PQLVQQDTRDSPVSN CHHHCCCCCCCCHHH	31.85	22369663
45	Phosphorylation	VQQDTRDSPVSNILS HCCCCCCCCHHHHHH	24.74	21440633
48	Phosphorylation	DTRDSPVSNILSQFH CCCCCCHHHHHHHHC	22.87	22369663
109	Acetylation	ADAIDFIKRKKRVFI HHHHHHHHHCCCEEE	59.15	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ENOPH_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ENOPH_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ENOPH_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RS8A_YEAST	RPS8A	genetic	20093466
RS8B_YEAST	RPS8A	genetic	20093466
RL4A_YEAST	RPL4A	genetic	20093466
CSG2_YEAST	CSG2	genetic	20093466
PEX10_YEAST	PEX10	genetic	20093466
LSB3_YEAST	LSB3	genetic	20093466
MED20_YEAST	SRB2	genetic	20093466
HTD2_YEAST	HTD2	genetic	20093466
THIK_YEAST	POT1	genetic	20093466
ASF1_YEAST	ASF1	genetic	20093466
DHOM_YEAST	HOM6	genetic	20093466
ALAM_YEAST	ALT1	genetic	20093466
RL6B_YEAST	RPL6B	genetic	20093466
VPS9_YEAST	VPS9	genetic	20093466
KAR5_YEAST	KAR5	genetic	20093466
OCA2_YEAST	OCA2	genetic	20093466
MSB4_YEAST	MSB4	genetic	20093466
PT127_YEAST	PET127	genetic	20093466
RU2A_YEAST	LEA1	genetic	20093466
UBA3_YEAST	UBA3	genetic	20093466
RL4A_YEAST	RPL4A	genetic	27708008
CSG2_YEAST	CSG2	genetic	27708008
MSH3_YEAST	MSH3	genetic	27708008
VAM6_YEAST	VAM6	genetic	27708008
MED20_YEAST	SRB2	genetic	27708008
HTD2_YEAST	HTD2	genetic	27708008
THIK_YEAST	POT1	genetic	27708008
MMS22_YEAST	MMS22	genetic	27708008
VPS9_YEAST	VPS9	genetic	27708008
KAR5_YEAST	KAR5	genetic	27708008
MSB4_YEAST	MSB4	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ENOPH_YEAST

Related Literatures of Post-Translational Modification