dbPTM

CYC2_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CYC2_DROME
UniProt AC	P84029
Protein Name	Cytochrome c-2
Gene Name	Cyt-c-p
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	108
Subcellular Localization	Mitochondrion intermembrane space . Loosely associated with the inner membrane.
Protein Description	Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain..
Protein Sequence	MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSATK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
10	Acetylation	VPAGDVEKGKKLFVQ CCCCHHHHCCEEHHH	75.72	21791702
104	Acetylation	GDLIAYLKSATK--- CCHHHHHHHHCC---	25.93	21791702

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CYC2_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CYC2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CYC2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EWG_DROME	ewg	physical	14605208
CPN_DROME	Cpn	physical	14605208
DORS_DROME	dl	physical	14605208
SAP47_DROME	Sap47	physical	14605208
TNNI_DROME	wupA	physical	22036573
TPM2_DROME	Tm2	physical	22036573
GPDA_DROME	Gpdh	physical	22036573
TNNT_DROME	up	physical	22036573
MLR_DROME	Mlc2	physical	22036573
MLC1_DROME	Mlc1	physical	22036573
MYSP1_DROME	Prm	physical	22036573
MYSP2_DROME	Prm	physical	22036573
CYC1_DROME	Cyt-c-d	genetic	16362035
CISY_DROME	kdn	physical	22036573

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CYC2_DROME

Related Literatures of Post-Translational Modification