CYC1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CYC1_DROME
• UniProt AC: P04657
• Protein Name: Cytochrome c-1
• Gene Name: Cyt-c-d
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 105
• Subcellular Localization: Mitochondrion intermembrane space. Loosely associated with the inner membrane.
• Protein Description: Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain..
• Protein Sequence: MGSGDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGVTWTEGNLDEYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLKSNK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CYC1_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CYC1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CYC1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CYC1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CYC2_DROME	Cyt-c-p	genetic	16362035

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.