UniProt ID | CLOCK_HUMAN | |
---|---|---|
UniProt AC | O15516 | |
Protein Name | Circadian locomoter output cycles protein kaput | |
Gene Name | CLOCK | |
Organism | Homo sapiens (Human). | |
Sequence Length | 846 | |
Subcellular Localization | Nucleus . Cytoplasm . Cytoplasm, cytosol . Shuffling between the cytoplasm and the nucleus is under circadian regulation and is ARNTL/BMAL1-dependent. Phosphorylated form located in the nucleus while the nonphosphorylated form found only in the cytop | |
Protein Description | Transcriptional activator which forms a core component of the circadian clock. The circadian clock, an internal time-keeping system, regulates various physiological processes through the generation of approximately 24 hour circadian rhythms in gene expression, which are translated into rhythms in metabolism and behavior. It is derived from the Latin roots 'circa' (about) and 'diem' (day) and acts as an important regulator of a wide array of physiological functions including metabolism, sleep, body temperature, blood pressure, endocrine, immune, cardiovascular, and renal function. Consists of two major components: the central clock, residing in the suprachiasmatic nucleus (SCN) of the brain, and the peripheral clocks that are present in nearly every tissue and organ system. Both the central and peripheral clocks can be reset by environmental cues, also known as Zeitgebers (German for 'timegivers'). The predominant Zeitgeber for the central clock is light, which is sensed by retina and signals directly to the SCN. The central clock entrains the peripheral clocks through neuronal and hormonal signals, body temperature and feeding-related cues, aligning all clocks with the external light/dark cycle. Circadian rhythms allow an organism to achieve temporal homeostasis with its environment at the molecular level by regulating gene expression to create a peak of protein expression once every 24 hours to control when a particular physiological process is most active with respect to the solar day. Transcription and translation of core clock components (CLOCK, NPAS2, ARNTL/BMAL1, ARNTL2/BMAL2, PER1, PER2, PER3, CRY1 and CRY2) plays a critical role in rhythm generation, whereas delays imposed by post-translational modifications (PTMs) are important for determining the period (tau) of the rhythms (tau refers to the period of a rhythm and is the length, in time, of one complete cycle). A diurnal rhythm is synchronized with the day/night cycle, while the ultradian and infradian rhythms have a period shorter and longer than 24 hours, respectively. Disruptions in the circadian rhythms contribute to the pathology of cardiovascular diseases, cancer, metabolic syndromes and aging. A transcription/translation feedback loop (TTFL) forms the core of the molecular circadian clock mechanism. Transcription factors, CLOCK or NPAS2 and ARNTL/BMAL1 or ARNTL2/BMAL2, form the positive limb of the feedback loop, act in the form of a heterodimer and activate the transcription of core clock genes and clock-controlled genes (involved in key metabolic processes), harboring E-box elements (5'-CACGTG-3') within their promoters. The core clock genes: PER1/2/3 and CRY1/2 which are transcriptional repressors form the negative limb of the feedback loop and interact with the CLOCK|NPAS2-ARNTL/BMAL1|ARNTL2/BMAL2 heterodimer inhibiting its activity and thereby negatively regulating their own expression. This heterodimer also activates nuclear receptors NR1D1/2 and RORA/B/G, which form a second feedback loop and which activate and repress ARNTL/BMAL1 transcription, respectively. Regulates the circadian expression of ICAM1, VCAM1, CCL2, THPO and MPL and also acts as an enhancer of the transactivation potential of NF-kappaB. Plays an important role in the homeostatic regulation of sleep. The CLOCK-ARNTL/BMAL1 heterodimer regulates the circadian expression of SERPINE1/PAI1, VWF, B3, CCRN4L/NOC, NAMPT, DBP, MYOD1, PPARGC1A, PPARGC1B, SIRT1, GYS2, F7, NGFR, GNRHR, BHLHE40/DEC1, ATF4, MTA1, KLF10 and also genes implicated in glucose and lipid metabolism. Promotes rhythmic chromatin opening, regulating the DNA accessibility of other transcription factors. The CLOCK-ARNTL2/BMAL2 heterodimer activates the transcription of SERPINE1/PAI1 and BHLHE40/DEC1. The preferred binding motif for the CLOCK-ARNTL/BMAL1 heterodimer is 5'-CACGTGA-3', which contains a flanking Ala residue in addition to the canonical 6-nucleotide E-box sequence. [PubMed: 23229515 CLOCK specifically binds to the half-site 5'-CAC-3', while ARNTL binds to the half-site 5'-GTGA-3'] | |
Protein Sequence | MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEALERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMVQRRSSFSSQSINSQSVGSSLTQPVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQSSQEQQLTSVQQPSQAQLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPDPSKVQPQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MLFTVSCSKMSSIVD CCEEEECCHHHHCCC | 24.72 | 30631047 | |
19 | Phosphorylation | SIVDRDDSSIFDGLV HCCCCCCCCCCCCCC | 29.62 | 27732954 | |
20 | Phosphorylation | IVDRDDSSIFDGLVE CCCCCCCCCCCCCCC | 33.98 | 27732954 | |
31 | Acetylation | GLVEEDDKDKAKRVS CCCCCCCHHHHHHHH | 73.73 | 20167786 | |
38 | Phosphorylation | KDKAKRVSRNKSEKK HHHHHHHHCCHHHHH | 33.88 | - | |
41 | Acetylation | AKRVSRNKSEKKRRD HHHHHCCHHHHHHHH | 59.90 | 20167786 | |
42 | Phosphorylation | KRVSRNKSEKKRRDQ HHHHCCHHHHHHHHH | 59.19 | - | |
59 | Phosphorylation | VLIKELGSMLPGNAR HHHHHHHHCCCCCHH | 29.75 | - | |
67 | Sumoylation | MLPGNARKMDKSTVL CCCCCHHCCCHHHHH | 49.38 | - | |
67 | Sumoylation | MLPGNARKMDKSTVL CCCCCHHCCCHHHHH | 49.38 | - | |
76 | Ubiquitination | DKSTVLQKSIDFLRK CHHHHHHHHHHHHHH | 45.26 | - | |
85 | Ubiquitination | IDFLRKHKEITAQSD HHHHHHCHHHHCCCC | 54.57 | 21906983 | |
88 | Phosphorylation | LRKHKEITAQSDASE HHHCHHHHCCCCHHH | 21.53 | 25954137 | |
164 | Phosphorylation | FIPEGEHSEVYKILS CCCCCCCHHHHHHHH | 25.18 | - | |
177 | Phosphorylation | LSTHLLESDSLTPEY HHHHHHHCCCCCHHH | 32.25 | 27067055 | |
179 | Phosphorylation | THLLESDSLTPEYLK HHHHHCCCCCHHHHH | 43.34 | 27251275 | |
186 | Ubiquitination | SLTPEYLKSKNQLEF CCCHHHHHCCCHHHH | 59.49 | 21906983 | |
205 | Ubiquitination | LRGTIDPKEPSTYEY HCCCCCCCCCCHHHE | 77.75 | - | |
331 | Phosphorylation | CHEHLMQYGKGKSCY HHHHHHHHCCCCCCE | 13.57 | 27273156 | |
394 | Phosphorylation | RELGIEESLPETAAD HHCCCCCCCCCCCCC | 36.11 | 25072903 | |
398 | Phosphorylation | IEESLPETAADKSQD CCCCCCCCCCCCCCC | 25.80 | 25072903 | |
402 | Ubiquitination | LPETAADKSQDSGSD CCCCCCCCCCCCCCC | 45.34 | 21906983 | |
403 | Phosphorylation | PETAADKSQDSGSDN CCCCCCCCCCCCCCC | 39.50 | 23663014 | |
406 | Phosphorylation | AADKSQDSGSDNRIN CCCCCCCCCCCCCCC | 32.34 | 30266825 | |
408 | Phosphorylation | DKSQDSGSDNRINTV CCCCCCCCCCCCCEE | 35.35 | 23663014 | |
414 | Phosphorylation | GSDNRINTVSLKEAL CCCCCCCEECHHHHH | 14.75 | 25072903 | |
416 | Phosphorylation | DNRINTVSLKEALER CCCCCEECHHHHHHH | 31.52 | 23090842 | |
418 | Ubiquitination | RINTVSLKEALERFD CCCEECHHHHHHHCC | 33.17 | 2190698 | |
427 | Phosphorylation | ALERFDHSPTPSASS HHHHCCCCCCCCCCC | 32.11 | 30266825 | |
429 | Phosphorylation | ERFDHSPTPSASSRS HHCCCCCCCCCCCCC | 32.65 | 30266825 | |
431 | Phosphorylation | FDHSPTPSASSRSSR CCCCCCCCCCCCCCC | 43.17 | 30266825 | |
433 | Phosphorylation | HSPTPSASSRSSRKS CCCCCCCCCCCCCCC | 30.53 | 23403867 | |
434 | Phosphorylation | SPTPSASSRSSRKSS CCCCCCCCCCCCCCC | 35.58 | 23403867 | |
437 | Phosphorylation | PSASSRSSRKSSHTA CCCCCCCCCCCCCCC | 42.49 | 22817900 | |
440 | Phosphorylation | SSRSSRKSSHTAVSD CCCCCCCCCCCCCCC | 26.66 | 28985074 | |
441 | Phosphorylation | SRSSRKSSHTAVSDP CCCCCCCCCCCCCCC | 28.08 | 25849741 | |
443 | Phosphorylation | SSRKSSHTAVSDPSS CCCCCCCCCCCCCCC | 30.60 | 23927012 | |
446 | Phosphorylation | KSSHTAVSDPSSTPT CCCCCCCCCCCCCCC | 41.14 | 25849741 | |
449 | Phosphorylation | HTAVSDPSSTPTKIP CCCCCCCCCCCCCCC | 52.41 | 25159151 | |
450 | Phosphorylation | TAVSDPSSTPTKIPT CCCCCCCCCCCCCCC | 43.74 | 23927012 | |
451 | Phosphorylation | AVSDPSSTPTKIPTD CCCCCCCCCCCCCCC | 39.04 | 23927012 | |
453 | Phosphorylation | SDPSSTPTKIPTDTS CCCCCCCCCCCCCCC | 41.51 | 23090842 | |
457 | Phosphorylation | STPTKIPTDTSTPPR CCCCCCCCCCCCCCH | 56.22 | 30266825 | |
459 | Phosphorylation | PTKIPTDTSTPPRQH CCCCCCCCCCCCHHC | 36.66 | 30266825 | |
460 | Phosphorylation | TKIPTDTSTPPRQHL CCCCCCCCCCCHHCC | 41.55 | 30266825 | |
461 | Phosphorylation | KIPTDTSTPPRQHLP CCCCCCCCCCHHCCC | 39.13 | 30266825 | |
702 | Dimethylation | FTQDRQIRFSQGQQL CCCCCEEEECHHHHH | 19.47 | - | |
702 | Methylation | FTQDRQIRFSQGQQL CCCCCEEEECHHHHH | 19.47 | - | |
704 | Phosphorylation | QDRQIRFSQGQQLVT CCCEEEECHHHHHHH | 24.45 | 28555341 | |
711 | O-linked_Glycosylation | SQGQQLVTKLVTAPV CHHHHHHHHHHHCCC | 27.53 | 23395176 | |
836 | Phosphorylation | LSRHRTDSLPDPSKV HHHHCCCCCCCHHHC | 40.98 | 26657352 | |
842 | Sumoylation | DSLPDPSKVQPQ--- CCCCCHHHCCCC--- | 50.72 | - | |
842 | Sumoylation | DSLPDPSKVQPQ--- CCCCCHHHCCCC--- | 50.72 | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLOCK_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLOCK_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BMAL1_HUMAN | ARNTL | physical | 14701734 | |
BMAL2_HUMAN | ARNTL2 | physical | 14701734 | |
BMAL1_HUMAN | ARNTL | physical | 11439184 | |
RARA_HUMAN | RARA | physical | 11439184 | |
BMAL1_HUMAN | ARNTL | physical | 20551151 | |
CRY1_HUMAN | CRY1 | physical | 23555304 | |
CRY2_HUMAN | CRY2 | physical | 23555304 | |
DEC1_HUMAN | DEC1 | physical | 23555304 | |
BHE41_HUMAN | BHLHE41 | physical | 23555304 | |
NPAS2_HUMAN | NPAS2 | physical | 23555304 | |
2A5D_HUMAN | PPP2R5D | physical | 23555304 | |
2A5E_HUMAN | PPP2R5E | physical | 23555304 | |
CSK2B_HUMAN | CSNK2B | physical | 23555304 | |
2AAB_HUMAN | PPP2R1B | physical | 23555304 | |
NR1D2_HUMAN | NR1D2 | physical | 23555304 | |
PER2_HUMAN | PER2 | physical | 23555304 | |
PP1A_HUMAN | PPP1CA | physical | 23555304 | |
PP1B_HUMAN | PPP1CB | physical | 23555304 | |
PP1G_HUMAN | PPP1CC | physical | 23555304 | |
KC1E_HUMAN | CSNK1E | physical | 23555304 | |
DBP_HUMAN | DBP | physical | 23555304 | |
RORG_HUMAN | RORC | physical | 23555304 | |
BMAL1_HUMAN | ARNTL | physical | 26164627 | |
PKN3_HUMAN | PKN3 | physical | 27173435 | |
VPS50_HUMAN | CCDC132 | physical | 27173435 | |
CAVN1_HUMAN | PTRF | physical | 27173435 | |
RPR1A_HUMAN | RPRD1A | physical | 27173435 | |
RABX5_HUMAN | RABGEF1 | physical | 27173435 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"An extensive survey of tyrosine phosphorylation revealing new sitesin human mammary epithelial cells."; Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A.,Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D.,Wiley H.S., Qian W.-J.; J. Proteome Res. 8:3852-3861(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-331, AND MASSSPECTROMETRY. |