| UniProt ID | BOL1_YEAST | |
|---|---|---|
| UniProt AC | Q3E793 | |
| Protein Name | BolA-like protein 1 {ECO:0000305} | |
| Gene Name | BOL1 {ECO:0000303|PubMed:27532772, ECO:0000303|PubMed:27532773} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 110 | |
| Subcellular Localization | Mitochondrion matrix . | |
| Protein Description | Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates [4Fe-4S] cluster insertion into a subset of mitochondrial proteins such as LIAS and succinate dehydrogenase (SDH). [PubMed: 27532772 Required during the last step of iron-sulfur protein assembly when the iron-sulfur cluster is inserted into the target protein] | |
| Protein Sequence | MFKRAMSTDGPVARTILKRLECGFPDYKNFAFGLYNDSHKHKGHAGVQGNVSAETHFRIEMVSKKFEGLKLPQRHRMVYSLLQDEMAQANGIHALQLSLKTPQEYESKAK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MFKRAMSTDGPVAR -CCCCCCCCCCHHHH | 19823750 | ||
| 8 | Phosphorylation | MFKRAMSTDGPVART CCCCCCCCCCHHHHH | 19823750 | ||
| 15 | Phosphorylation | TDGPVARTILKRLEC CCCHHHHHHHHHHCC | 19823750 | ||
| 40 | Acetylation | GLYNDSHKHKGHAGV ECCCCCCCCCCCCCC | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BOL1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BOL1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BOL1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MPA43_YEAST | MPA43 | physical | 18719252 | |
| GLRX3_YEAST | GRX3 | physical | 18719252 | |
| WRIP1_YEAST | MGS1 | physical | 18719252 | |
| GLRX4_YEAST | GRX4 | physical | 18719252 | |
| BOL3_YEAST | AIM1 | genetic | 27532773 | |
| GLRX5_YEAST | GRX5 | physical | 27532773 | |
| RPB1_YEAST | RPO21 | genetic | 27708008 | |
| ERF3_YEAST | SUP35 | genetic | 27708008 | |
| CDC1_YEAST | CDC1 | genetic | 27708008 | |
| SNU56_YEAST | SNU56 | genetic | 27708008 | |
| DPB11_YEAST | DPB11 | genetic | 27708008 | |
| CDC11_YEAST | CDC11 | genetic | 27708008 | |
| MTU1_YEAST | SLM3 | genetic | 27708008 | |
| BCS1_YEAST | BCS1 | genetic | 27708008 | |
| RV167_YEAST | RVS167 | genetic | 27708008 | |
| XRN1_YEAST | XRN1 | genetic | 27708008 | |
| SNF6_YEAST | SNF6 | genetic | 27708008 | |
| VPS53_YEAST | VPS53 | genetic | 27708008 | |
| GSH1_YEAST | GSH1 | genetic | 27708008 | |
| RS10A_YEAST | RPS10A | genetic | 27708008 | |
| BOL3_YEAST | AIM1 | genetic | 27532772 | |
| GLRX3_HUMAN | GLRX3 | physical | 27107014 | |
| BIRC2_HUMAN | BIRC2 | physical | 27107014 | |
| XIAP_HUMAN | XIAP | physical | 27107014 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
