| UniProt ID | GLRX5_YEAST | |
|---|---|---|
| UniProt AC | Q02784 | |
| Protein Name | Monothiol glutaredoxin-5, mitochondrial | |
| Gene Name | GRX5 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 150 | |
| Subcellular Localization | Mitochondrion matrix . | |
| Protein Description | Monothiol glutaredoxin involved in iron-sulfur biogenesis. [PubMed: 11950925] | |
| Protein Sequence | MFLPKFNPIRSFSPILRAKTLLRYQNRMYLSTEIRKAIEDAIESAPVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKFAAYNVLEDPELREGIKEFSEWPTIPQLYVNKEFIGGCDVITSMARSGELADLLEEAQALVPEEEEETKDR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Phosphorylation | PKFNPIRSFSPILRA CCCCCCCCCHHHHHH | 30.69 | 21440633 | |
| 52 | Acetylation | APVVLFMKGTPEFPK CCEEEEECCCCCCCC | 52.91 | 24489116 | |
| 52 | Succinylation | APVVLFMKGTPEFPK CCEEEEECCCCCCCC | 52.91 | 23954790 | |
| 59 | Acetylation | KGTPEFPKCGFSRAT CCCCCCCCCCCCHHH | 52.92 | 24489116 | |
| 79 | Acetylation | NQGVDPAKFAAYNVL CCCCCHHHHHHHHHH | 40.71 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLRX5_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLRX5_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLRX5_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SLM1_YEAST | SLM1 | physical | 10688190 | |
| SLM2_YEAST | SLM2 | physical | 10688190 | |
| KDX1_YEAST | KDX1 | genetic | 14722110 | |
| SLM1_YEAST | SLM1 | physical | 11283351 | |
| HSP7F_YEAST | SSE1 | physical | 19536198 | |
| ISA2_YEAST | ISA2 | genetic | 11950925 | |
| HSP7Q_YEAST | SSQ1 | genetic | 11950925 | |
| GLRX4_YEAST | GRX4 | genetic | 15456753 | |
| GLRX3_YEAST | GRX3 | genetic | 15456753 | |
| SPT10_YEAST | SPT10 | physical | 22326886 | |
| HSP7Q_YEAST | SSQ1 | physical | 23615440 | |
| HSP77_YEAST | SSC1 | physical | 23615440 | |
| UBC2_YEAST | RAD6 | genetic | 26567217 | |
| RAD50_YEAST | RAD50 | genetic | 26567217 | |
| RAD52_YEAST | RAD52 | genetic | 26567217 | |
| DUN1_YEAST | DUN1 | genetic | 26567217 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
