ISA2_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ISA2_YEAST
• UniProt AC: Q12425
• Protein Name: Iron-sulfur assembly protein 2
• Gene Name: ISA2
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 185
• Subcellular Localization: Mitochondrion matrix.
• Protein Description: Involved in the assembly of mitochondrial and cytoplasmic iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly..
• Protein Sequence: MQAKLLFTRLNFRRPSTTLRQFPLTCFLFHSKAFYSDLVTKEPLITPKRIINKTPGLNLSISERASNRLAEIYRNSKENLRISVESGGCHGFQYNLTLEPATKPDIKNDVKDKEFSDDLDDDDSKDIIYVLPEDKGRVIIDSKSLNILNNTTLTYTNELIGSSFKIINGSLKSSCGCGSSFDIEN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
116	Phosphorylation	DVKDKEFSDDLDDDD CCCCCCCCCCCCCCC	31.16	21440633
124	Phosphorylation	DDLDDDDSKDIIYVL CCCCCCCCCCEEEEC	38.94	21440633
135	Acetylation	IYVLPEDKGRVIIDS EEECCCCCCCEEECC	47.13	24489116
142	Phosphorylation	KGRVIIDSKSLNILN CCCEEECCCCEEECC	17.46	27717283

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ISA2_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ISA2_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ISA2_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FET3_YEAST	FET3	genetic	10805735
CAF17_YEAST	IBA57	physical	18086897
SRS2_YEAST	SRS2	genetic	21459050

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.