UniProt ID | ISA2_YEAST | |
---|---|---|
UniProt AC | Q12425 | |
Protein Name | Iron-sulfur assembly protein 2 | |
Gene Name | ISA2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 185 | |
Subcellular Localization | Mitochondrion matrix. | |
Protein Description | Involved in the assembly of mitochondrial and cytoplasmic iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.. | |
Protein Sequence | MQAKLLFTRLNFRRPSTTLRQFPLTCFLFHSKAFYSDLVTKEPLITPKRIINKTPGLNLSISERASNRLAEIYRNSKENLRISVESGGCHGFQYNLTLEPATKPDIKNDVKDKEFSDDLDDDDSKDIIYVLPEDKGRVIIDSKSLNILNNTTLTYTNELIGSSFKIINGSLKSSCGCGSSFDIEN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
116 | Phosphorylation | DVKDKEFSDDLDDDD CCCCCCCCCCCCCCC | 31.16 | 21440633 | |
124 | Phosphorylation | DDLDDDDSKDIIYVL CCCCCCCCCCEEEEC | 38.94 | 21440633 | |
135 | Acetylation | IYVLPEDKGRVIIDS EEECCCCCCCEEECC | 47.13 | 24489116 | |
142 | Phosphorylation | KGRVIIDSKSLNILN CCCEEECCCCEEECC | 17.46 | 27717283 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ISA2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ISA2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ISA2_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FET3_YEAST | FET3 | genetic | 10805735 | |
CAF17_YEAST | IBA57 | physical | 18086897 | |
SRS2_YEAST | SRS2 | genetic | 21459050 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...