BIRC7_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BIRC7_HUMAN
• UniProt AC: Q96CA5
• Protein Name: Baculoviral IAP repeat-containing protein 7
• Gene Name: BIRC7
• Organism: Homo sapiens (Human).
• Sequence Length: 298
• Subcellular Localization: Nucleus . Cytoplasm . Golgi apparatus . Nuclear, and in a filamentous pattern throughout the cytoplasm. Full-length livin is detected exclusively in the cytoplasm, whereas the truncated form (tLivin) is found in the peri-nuclear region with marked lo
• Protein Description: Apoptotic regulator capable of exerting proapoptotic and anti-apoptotic activities and plays crucial roles in apoptosis, cell proliferation, and cell cycle control. Its anti-apoptotic activity is mediated through the inhibition of CASP3, CASP7 and CASP9, as well as by its E3 ubiquitin-protein ligase activity. As it is a weak caspase inhibitor, its anti-apoptotic activity is thought to be due to its ability to ubiquitinate DIABLO/SMAC targeting it for degradation thereby promoting cell survival. May contribute to caspase inhibition, by blocking the ability of DIABLO/SMAC to disrupt XIAP/BIRC4-caspase interactions. Protects against apoptosis induced by TNF or by chemical agents such as adriamycin, etoposide or staurosporine. Suppression of apoptosis is mediated by activation of MAPK8/JNK1, and possibly also of MAPK9/JNK2. This activation depends on TAB1 and NR2C2/TAK1. In vitro, inhibits CASP3 and proteolytic activation of pro-CASP9. Isoform 1 blocks staurosporine-induced apoptosis. Isoform 2 blocks etoposide-induced apoptosis. Isoform 2 protects against natural killer (NK) cell killing whereas isoform 1 augments killing..
• Protein Sequence: MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
37	Phosphorylation	CGPRSLGSPVLGLDT CCCCCCCCCCCCCCC	19.68	25850435
86	Phosphorylation	PAFPGMGSEELRLAS CCCCCCCCCHHHHCC	21.00	-
220	Phosphorylation	AQEPGGVSPAEAQRA CCCCCCCCHHHHHHH	22.97	25159151

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BIRC7_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BIRC7_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BIRC7_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CASP7_HUMAN	CASP7	physical	11024045
CASP3_HUMAN	CASP3	physical	11024045
XAF1_HUMAN	XAF1	physical	17613533
UB2E1_HUMAN	UBE2E1	physical	21113135
UB2D1_HUMAN	UBE2D1	physical	21113135
UB2D2_HUMAN	UBE2D2	physical	21113135
UB2D3_HUMAN	UBE2D3	physical	21113135
UBC9_HUMAN	UBE2I	physical	21113135
BIRC2_HUMAN	BIRC2	physical	21113135
BIRC7_HUMAN	BIRC7	physical	21113135
UB2D2_HUMAN	UBE2D2	physical	22902369
UBC_HUMAN	UBC	physical	22902369
DBLOH_HUMAN	DIABLO	physical	11801603
HTRA2_HUMAN	HTRA2	physical	11801603
CASP9_HUMAN	CASP9	physical	11801603
DBLOH_HUMAN	DIABLO	physical	12620238
RAF1_HUMAN	RAF1	physical	22711539
XIAP_HUMAN	XIAP	physical	22711539
BIRC2_HUMAN	BIRC2	physical	22711539
CASP9_HUMAN	CASP9	physical	11084335
CASP3_HUMAN	CASP3	physical	23563149
DBLOH_HUMAN	DIABLO	physical	16729033
UB2D2_HUMAN	UBE2D2	physical	16729033
F124B_HUMAN	FAM124B	physical	25416956
BIRC7_HUMAN	BIRC7	physical	22902369
DBLOH_HUMAN	DIABLO	physical	22902369
PCNT_HUMAN	PCNT	physical	26186194
BIRC2_HUMAN	BIRC2	physical	26186194
Z3H7A_HUMAN	ZC3H7A	physical	26186194
XIAP_HUMAN	XIAP	physical	26186194
HTRA2_HUMAN	HTRA2	physical	26186194
DBLOH_HUMAN	DIABLO	physical	26186194
IKBB_HUMAN	NFKBIB	physical	26186194
OSTM1_HUMAN	OSTM1	physical	26186194
DHRS4_HUMAN	DHRS4	physical	26186194
WIZ_HUMAN	WIZ	physical	26186194
CLCN7_HUMAN	CLCN7	physical	26186194
DBLOH_HUMAN	DIABLO	physical	26412467
IKBB_HUMAN	NFKBIB	physical	28514442
OSTM1_HUMAN	OSTM1	physical	28514442
Z3H7A_HUMAN	ZC3H7A	physical	28514442
PCNT_HUMAN	PCNT	physical	28514442
DBLOH_HUMAN	DIABLO	physical	28514442
XIAP_HUMAN	XIAP	physical	28514442
DHRS4_HUMAN	DHRS4	physical	28514442
CLCN7_HUMAN	CLCN7	physical	28514442
HTRA2_HUMAN	HTRA2	physical	28514442
BIRC2_HUMAN	BIRC2	physical	28514442
JIP4_HUMAN	SPAG9	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.