AP1S2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AP1S2_HUMAN
• UniProt AC: P56377
• Protein Name: AP-1 complex subunit sigma-2
• Gene Name: AP1S2
• Organism: Homo sapiens (Human).
• Sequence Length: 157
• Subcellular Localization: Golgi apparatus. Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Membrane, clathrin-coated pit. Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.
• Protein Description: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules..
• Protein Sequence: MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MQFMLLFSRQGKLRL CCEEEEEECCCCEEE	24.54	24719451
17	Ubiquitination	QGKLRLQKWYVPLSD CCCEEEEEEECCCCH	45.12	21890473
25	Ubiquitination	WYVPLSDKEKKKITR EECCCCHHHHHHHHH	68.97	-
31	Phosphorylation	DKEKKKITRELVQTV HHHHHHHHHHHHHHH	27.28	22210691
42	Malonylation	VQTVLARKPKMCSFL HHHHHHCCCCCCCCC	43.30	26320211
58	Phosphorylation	WRDLKIVYKRYASLY CCCHHHHHHHHHEEE	8.01	46164969
59	Ubiquitination	RDLKIVYKRYASLYF CCHHHHHHHHHEEEE	28.21	21890473
86	Phosphorylation	TLEIIHRYVELLDKY EHHHHHHHHHHHHHH	5.54	11169821
93	Phosphorylation	YVELLDKYFGSVCEL HHHHHHHHCCCCEEE	16.91	11169829
132	Ubiquitination	TSKKNVLKAIEQADL HCHHHHHHHHHHHHH	42.93	-
146	Phosphorylation	LLQEEAETPRSVLEE HHHHHCCCHHHHHHH	30.93	29255136

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AP1S2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AP1S2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AP1S2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AP1G1_HUMAN	AP1G1	physical	9733768
AP1G2_HUMAN	AP1G2	physical	9733768
AP1G1_HUMAN	AP1G1	physical	26344197
AP1B1_HUMAN	AP1B1	physical	26496610
AP2B1_HUMAN	AP2B1	physical	26496610
AP1G1_HUMAN	AP1G1	physical	26496610
CLCA_HUMAN	CLTA	physical	26496610
CPSM_HUMAN	CPS1	physical	26496610
VKGC_HUMAN	GGCX	physical	26496610
SEC13_HUMAN	SEC13	physical	26496610
AP1G2_HUMAN	AP1G2	physical	26496610
AP1M1_HUMAN	AP1M1	physical	26496610
UBC12_HUMAN	UBE2M	physical	26496610
ABCG1_HUMAN	ABCG1	physical	26496610
EPN4_HUMAN	CLINT1	physical	26496610
NUDT3_HUMAN	NUDT3	physical	26496610
SYNRG_HUMAN	SYNRG	physical	26496610
S43A3_HUMAN	SLC43A3	physical	26496610
NOP58_HUMAN	NOP58	physical	26496610
HTR5B_HUMAN	HEATR5B	physical	26496610
AFTIN_HUMAN	AFTPH	physical	26496610
AP1AR_HUMAN	AP1AR	physical	26496610
NBEL1_HUMAN	NBEAL1	physical	26496610
TIM29_HUMAN	C19orf52	physical	26496610
SYNRG_HUMAN	SYNRG	physical	28514442
AFTIN_HUMAN	AFTPH	physical	28514442
HTR5B_HUMAN	HEATR5B	physical	28514442
AP1G2_HUMAN	AP1G2	physical	28514442
AP1G1_HUMAN	AP1G1	physical	28514442
AP1M1_HUMAN	AP1M1	physical	28514442
AAGAB_HUMAN	AAGAB	physical	28514442
AP1B1_HUMAN	AP1B1	physical	28514442
AP1AR_HUMAN	AP1AR	physical	28514442
AP2B1_HUMAN	AP2B1	physical	28514442
VTI1B_HUMAN	VTI1B	physical	28514442
STX8_HUMAN	STX8	physical	28514442
EPN4_HUMAN	CLINT1	physical	28514442
CCM2_HUMAN	CCM2	physical	28514442

Drug and Disease Associations

• Kegg Disease
• OMIM Disease
• 304340: Pettigrew syndrome (PGS)
• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.