UniProt ID | YO316_YEAST | |
---|---|---|
UniProt AC | Q3E806 | |
Protein Name | Uncharacterized protein YOR316C-A | |
Gene Name | YOR316C-A | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 69 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MLVPMHNSPTAANGRLSLTVASSGLRKGKKNRVYTIHSYIRSPVSSSEFSFSVRRQYKLTIRIKQKTHL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YO316_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YO316_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YO316_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YO316_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SEC12_YEAST | SEC12 | genetic | 27708008 | |
RS27B_YEAST | RPS27B | genetic | 27708008 | |
CDC24_YEAST | CDC24 | genetic | 27708008 | |
SEC18_YEAST | SEC18 | genetic | 27708008 | |
LCB2_YEAST | LCB2 | genetic | 27708008 | |
PDC2_YEAST | PDC2 | genetic | 27708008 | |
PMM_YEAST | SEC53 | genetic | 27708008 | |
RRN7_YEAST | RRN7 | genetic | 27708008 | |
ARP4_YEAST | ARP4 | genetic | 27708008 | |
MED14_YEAST | RGR1 | genetic | 27708008 | |
RU1C_YEAST | YHC1 | genetic | 27708008 | |
POB3_YEAST | POB3 | genetic | 27708008 | |
MCM1_YEAST | MCM1 | genetic | 27708008 | |
NHP10_YEAST | NHP10 | genetic | 27708008 | |
ASK10_YEAST | ASK10 | genetic | 27708008 | |
THIK_YEAST | POT1 | genetic | 27708008 | |
YJ24_YEAST | KCH1 | genetic | 27708008 | |
ILM1_YEAST | ILM1 | genetic | 27708008 | |
RL22A_YEAST | RPL22A | genetic | 27708008 | |
ZRC1_YEAST | ZRC1 | genetic | 27708008 | |
BUD21_YEAST | BUD21 | genetic | 27708008 | |
VPS17_YEAST | VPS17 | genetic | 27708008 | |
RL21B_YEAST | RPL21B | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...