UniProt ID | YFM7_YEAST | |
---|---|---|
UniProt AC | P43625 | |
Protein Name | Uncharacterized protein YFR057W | |
Gene Name | YFR057W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 151 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MIFGPTSVYSKCSAKSSGIIKDTAKLPISRVRIKVMLEITVSFLFFDRFPRSFLNHNLYDSICPFFAWQYTSYYLSIYRQSFLFHFLQKDFSNDFVSEELIYALVALGAKNSFDNSLSKHTYEYYNHSKRNLLEDSTNKNSAFSSASVTKP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Phosphorylation | TSVYSKCSAKSSGII CHHHHHHCCCCCCCC | 42.33 | 29688323 | |
16 | Phosphorylation | YSKCSAKSSGIIKDT HHHHCCCCCCCCCCC | 33.25 | 29688323 | |
17 | Phosphorylation | SKCSAKSSGIIKDTA HHHCCCCCCCCCCCC | 33.05 | 29688323 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YFM7_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YFM7_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YFM7_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HAP5_YEAST | HAP5 | genetic | 20959818 | |
HOS2_YEAST | HOS2 | genetic | 20959818 | |
CKS1_YEAST | CKS1 | genetic | 27708008 | |
APC11_YEAST | APC11 | genetic | 27708008 | |
TECR_YEAST | TSC13 | genetic | 27708008 | |
PDC2_YEAST | PDC2 | genetic | 27708008 | |
TAF12_YEAST | TAF12 | genetic | 27708008 | |
GPI8_YEAST | GPI8 | genetic | 27708008 | |
RPB7_YEAST | RPB7 | genetic | 27708008 | |
PRS8_YEAST | RPT6 | genetic | 27708008 | |
SWC4_YEAST | SWC4 | genetic | 27708008 | |
SYMC_YEAST | MES1 | genetic | 27708008 | |
FIP1_YEAST | FIP1 | genetic | 27708008 | |
BET3_YEAST | BET3 | genetic | 27708008 | |
SYH_YEAST | HTS1 | genetic | 27708008 | |
ARP7_YEAST | ARP7 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...