UniProt ID | YA063_YEAST | |
---|---|---|
UniProt AC | Q3E791 | |
Protein Name | Uncharacterized protein YAL063C-A | |
Gene Name | YAL063C-A | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 96 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MCPRTVLLIININHWFYDKNIVRIILTFRLDSGHISDICFINKNLANALITADISLLKRHDIRCTKYIITYYQRYRNKEKGKFISLCKNTIISSSV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YA063_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YA063_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YA063_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YA063_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TF2B_YEAST | SUA7 | genetic | 27708008 | |
MRM2_YEAST | MRM2 | genetic | 27708008 | |
ASK10_YEAST | ASK10 | genetic | 27708008 | |
INO4_YEAST | INO4 | genetic | 27708008 | |
CALM_YEAST | CMD1 | genetic | 27708008 | |
APC11_YEAST | APC11 | genetic | 27708008 | |
FAL1_YEAST | FAL1 | genetic | 27708008 | |
CDC20_YEAST | CDC20 | genetic | 27708008 | |
SPC97_YEAST | SPC97 | genetic | 27708008 | |
FDFT_YEAST | ERG9 | genetic | 27708008 | |
MET30_YEAST | MET30 | genetic | 27708008 | |
MCM10_YEAST | MCM10 | genetic | 27708008 | |
BET3_YEAST | BET3 | genetic | 27708008 | |
PRP19_YEAST | PRP19 | genetic | 27708008 | |
TAF11_YEAST | TAF11 | genetic | 27708008 | |
DPOA_YEAST | POL1 | genetic | 27708008 | |
IPL1_YEAST | IPL1 | genetic | 27708008 | |
SIC1_YEAST | SIC1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...