| UniProt ID | YA063_YEAST | |
|---|---|---|
| UniProt AC | Q3E791 | |
| Protein Name | Uncharacterized protein YAL063C-A | |
| Gene Name | YAL063C-A | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 96 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MCPRTVLLIININHWFYDKNIVRIILTFRLDSGHISDICFINKNLANALITADISLLKRHDIRCTKYIITYYQRYRNKEKGKFISLCKNTIISSSV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YA063_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YA063_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YA063_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YA063_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TF2B_YEAST | SUA7 | genetic | 27708008 | |
| MRM2_YEAST | MRM2 | genetic | 27708008 | |
| ASK10_YEAST | ASK10 | genetic | 27708008 | |
| INO4_YEAST | INO4 | genetic | 27708008 | |
| CALM_YEAST | CMD1 | genetic | 27708008 | |
| APC11_YEAST | APC11 | genetic | 27708008 | |
| FAL1_YEAST | FAL1 | genetic | 27708008 | |
| CDC20_YEAST | CDC20 | genetic | 27708008 | |
| SPC97_YEAST | SPC97 | genetic | 27708008 | |
| FDFT_YEAST | ERG9 | genetic | 27708008 | |
| MET30_YEAST | MET30 | genetic | 27708008 | |
| MCM10_YEAST | MCM10 | genetic | 27708008 | |
| BET3_YEAST | BET3 | genetic | 27708008 | |
| PRP19_YEAST | PRP19 | genetic | 27708008 | |
| TAF11_YEAST | TAF11 | genetic | 27708008 | |
| DPOA_YEAST | POL1 | genetic | 27708008 | |
| IPL1_YEAST | IPL1 | genetic | 27708008 | |
| SIC1_YEAST | SIC1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...