TM258_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TM258_HUMAN
• UniProt AC: P61165
• Protein Name: Transmembrane protein 258
• Gene Name: TMEM258
• Organism: Homo sapiens (Human).
• Sequence Length: 79
• Subcellular Localization: Membrane ; Multi-pass membrane protein . Endoplasmic reticulum .
• Protein Description: Acts as component of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Required for full OST catalytic activity in N-glycosylation. [PubMed: 26472760]
• Protein Sequence: MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MELEAMSR -------CCHHHHHH		22223895
51	Phosphorylation	TKYTRDIYKELLISL CCHHHHHHHHHHHHH		-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TM258_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TM258_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TM258_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RPN1_HUMAN	RPN1	physical	26472760
RPN2_HUMAN	RPN2	physical	26472760
STT3A_HUMAN	STT3A	physical	26472760
OST48_HUMAN	DDOST	physical	26472760
STT3B_HUMAN	STT3B	physical	26472760
MAGT1_HUMAN	MAGT1	physical	26472760
CALX_HUMAN	CANX	physical	26472760
MLEC_HUMAN	MLEC	physical	26472760
CD032_HUMAN	C4orf32	physical	26472760
DAD1_HUMAN	DAD1	physical	26472760
SCPDL_HUMAN	SCCPDH	physical	26472760
FKBP8_HUMAN	FKBP8	physical	26472760
CC167_HUMAN	CCDC167	physical	26472760
HACD3_HUMAN	PTPLAD1	physical	26472760
HS2ST_HUMAN	HS2ST1	physical	26472760
STX12_HUMAN	STX12	physical	26472760
FUT8_HUMAN	FUT8	physical	26472760

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.