| UniProt ID | CC167_HUMAN | |
|---|---|---|
| UniProt AC | Q9P0B6 | |
| Protein Name | Coiled-coil domain-containing protein 167 | |
| Gene Name | CCDC167 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 97 | |
| Subcellular Localization |
Membrane Single-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MTKKKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKASNYEKELKFLRQENRKNMLLSVAIFILLTLVYAYWTM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 21 | Ubiquitination | EIDGLEEKLSQCRRD CCCCHHHHHHHHHHH | 44.02 | 32015554 | |
| 38 | Phosphorylation | AVNSRLHSRELSPEA HHHHHHHHCCCCHHH | 31.85 | 26074081 | |
| 42 | Phosphorylation | RLHSRELSPEARRSL HHHHCCCCHHHHHHH | 18.88 | 23401153 | |
| 48 | Phosphorylation | LSPEARRSLEKEKNS CCHHHHHHHHHHHHH | 35.01 | 24719451 | |
| 59 | Ubiquitination | EKNSLMNKASNYEKE HHHHHHHHHHHHHHH | 38.95 | 32015554 | |
| 63 | Phosphorylation | LMNKASNYEKELKFL HHHHHHHHHHHHHHH | 26.36 | 20736484 | |
| 65 | Ubiquitination | NKASNYEKELKFLRQ HHHHHHHHHHHHHHH | 58.97 | - | |
| 81 | Phosphorylation | NRKNMLLSVAIFILL HHHHHHHHHHHHHHH | 12.92 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CC167_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CC167_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CC167_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CC167_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...