UniProt ID | CC167_HUMAN | |
---|---|---|
UniProt AC | Q9P0B6 | |
Protein Name | Coiled-coil domain-containing protein 167 | |
Gene Name | CCDC167 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 97 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MTKKKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKASNYEKELKFLRQENRKNMLLSVAIFILLTLVYAYWTM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Ubiquitination | EIDGLEEKLSQCRRD CCCCHHHHHHHHHHH | 44.02 | 32015554 | |
38 | Phosphorylation | AVNSRLHSRELSPEA HHHHHHHHCCCCHHH | 31.85 | 26074081 | |
42 | Phosphorylation | RLHSRELSPEARRSL HHHHCCCCHHHHHHH | 18.88 | 23401153 | |
48 | Phosphorylation | LSPEARRSLEKEKNS CCHHHHHHHHHHHHH | 35.01 | 24719451 | |
59 | Ubiquitination | EKNSLMNKASNYEKE HHHHHHHHHHHHHHH | 38.95 | 32015554 | |
63 | Phosphorylation | LMNKASNYEKELKFL HHHHHHHHHHHHHHH | 26.36 | 20736484 | |
65 | Ubiquitination | NKASNYEKELKFLRQ HHHHHHHHHHHHHHH | 58.97 | - | |
81 | Phosphorylation | NRKNMLLSVAIFILL HHHHHHHHHHHHHHH | 12.92 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CC167_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CC167_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CC167_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CC167_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...