DAD1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DAD1_HUMAN
• UniProt AC: P61803
• Protein Name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
• Gene Name: DAD1
• Organism: Homo sapiens (Human).
• Sequence Length: 113
• Subcellular Localization: Endoplasmic reticulum membrane; Multi-pass membrane protein .
• Protein Description: Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Required for the assembly of both SST3A- and SS3B-containing OST complexes. Required for efficient N-glycosylation. Loss of the DAD1 protein triggers apoptosis..
• Protein Sequence: MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSASVVSVI ------CCHHHHHHH	29.29	20068231
2	Phosphorylation	------MSASVVSVI ------CCHHHHHHH	29.29	20068231
4	Phosphorylation	----MSASVVSVISR ----CCHHHHHHHHH	18.75	21406692
7	Phosphorylation	-MSASVVSVISRFLE -CCHHHHHHHHHHHH	16.16	21406692
10	Phosphorylation	ASVVSVISRFLEEYL HHHHHHHHHHHHHHH	18.15	21406692
16	Phosphorylation	ISRFLEEYLSSTPQR HHHHHHHHHHCCHHH	11.51	28152594
18	Phosphorylation	RFLEEYLSSTPQRLK HHHHHHHHCCHHHHH	31.12	28152594
19	Phosphorylation	FLEEYLSSTPQRLKL HHHHHHHCCHHHHHH	41.32	28152594
20	Phosphorylation	LEEYLSSTPQRLKLL HHHHHHCCHHHHHHH	21.77	-
82	Ubiquitination	IQINPQNKADFQGIS CCCCCCCCHHCCCCC	44.05	21890473

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DAD1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DAD1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DAD1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MCL1_HUMAN	MCL1	physical	10965038

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.