dbPTM

TIF6B_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TIF6B_ARATH
UniProt AC	Q9LVI4
Protein Name	Protein TIFY 6B
Gene Name	TIFY6B
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	352
Subcellular Localization	Nucleus .
Protein Description	Repressor of jasmonate responses. Jasmonoyl-isoleucine (JA-Ile) specifically promotes COI1-TIFY6B/JAZ3 interaction. Acts as a negative regulator of MYC2 function. Feed-back regulated by MYC2..
Protein Sequence	MERDFLGLGSKNSPITVKEETSESSRDSAPNRGMNWSFSNKVSASSSQFLSFRPTQEDRHRKSGNYHLPHSGSFMPSSVADVYDSTRKAPYSSVQGVRMFPNSNQHEETNAVSMSMPGFQSHHYAPGGRSFMNNNNNSQPLVGVPIMAPPISILPPPGSIVGTTDIRSSSKPIGSPAQLTIFYAGSVCVYDDISPEKAKAIMLLAGNGSSMPQVFSPPQTHQQVVHHTRASVDSSAMPPSFMPTISYLSPEAGSSTNGLGATKATRGLTSTYHNNQANGSNINCPVPVSCSTNVMAPTVALPLARKASLARFLEKRKERVTSVSPYCLDKKSSTDCRRSMSECISSSLSSAT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of TIF6B_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	COI1	O04197	PMID:22199232

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TIF6B_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TIF6B_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MYC2_ARATH	MYC2	physical	17637677
COI1_ARATH	COI1	physical	17637675
MYC2_ARATH	MYC2	physical	17637675
COI1_ARATH	COI1	physical	20525008
MYC4_ARATH	AT4G17880	physical	21321051
MYC2_ARATH	MYC2	physical	21321051
MYC3_ARATH	AT5G46760	physical	21321051
MYC2_ARATH	MYC2	physical	21335373
MYC3_ARATH	AT5G46760	physical	21335373
MYC4_ARATH	AT4G17880	physical	21335373
TIF6B_ARATH	JAZ3	physical	21335373
TPR1_ARATH	TPR1	physical	21335373
KAD6_ARATH	AT5G60340	physical	21798944
NADB_ARATH	AO	physical	21798944
CDKC1_ARATH	CDKC;1	physical	21798944
GRXC8_ARATH	ROXY2	physical	21798944
KIN11_ARATH	KIN11	physical	21798944
TOE2_ARATH	TOE2	physical	21798944
RBS2B_ARATH	AT5G38420	physical	21798944
EXLB1_ARATH	EXLB1	physical	21798944
MP705_ARATH	MAP70-5	physical	21798944
GRXS3_ARATH	AT4G15700	physical	21798944
KAN1_ARATH	KAN	physical	21798944
COI1_ARATH	COI1	physical	19309455
MYC2_ARATH	MYC2	physical	19309455
TIF6B_ARATH	JAZ3	physical	19309455
TIF6A_ARATH	JAZ4	physical	19309455
TIF7_ARATH	TIFY7	physical	19309455
BH013_ARATH	AT1G01260	physical	23935516
AIB_ARATH	AIB	physical	23935516
TIF6B_ARATH	JAZ3	physical	19151223
TI10A_ARATH	JAZ1	physical	19151223
TI10B_ARATH	TIFY10B	physical	19151223
TIF6A_ARATH	JAZ4	physical	19151223
TIF5A_ARATH	JAZ8	physical	19151223
TIF7_ARATH	TIFY7	physical	19151223
TIF9_ARATH	JAZ10	physical	19151223
TIF3A_ARATH	JAZ11	physical	19151223
RAP27_ARATH	RAP2.7	physical	26410299
TOE2_ARATH	TOE2	physical	26410299

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TIF6B_ARATH

Related Literatures of Post-Translational Modification