GRXC8_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GRXC8_ARATH
• UniProt AC: Q8LF89
• Protein Name: Glutaredoxin-C8
• Gene Name: GRXC8
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 140
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins (By similarity). Involved in flower development..
• Protein Sequence: MQYKTETRGSLSYNNNSKVMNNMNVFPSETLAKIESMAAENAVVIFSVSTCCMCHAIKRLFRGMGVSPAVHELDLLPYGVEIHRALLRLLGCSSGGATSPGALPVVFIGGKMVGAMERVMASHINGSLVPLLKDAGALWL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
17	Phosphorylation	SLSYNNNSKVMNNMN CCCCCCCCCCCCCCC	28.84	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GRXC8_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GRXC8_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GRXC8_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TGA2_ARATH	AHBP-1B	physical	20805327
KAN1_ARATH	KAN	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.