| UniProt ID | TIF5A_ARATH | |
|---|---|---|
| UniProt AC | Q8LBM2 | |
| Protein Name | Protein TIFY 5A {ECO:0000303|PubMed:17499004} | |
| Gene Name | TIFY5A {ECO:0000303|PubMed:17499004} | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 131 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Repressor of jasmonate responses. Unable to associate strongly with COI1 in the presence of jasmonoyl-isoleucine (JA-Ile) and is therefore more resistant to JA-medisted-degradation than other TIFY/JAZ proteins. Repress gene expression through direct recruitment of the corepressor TOPLESS to cognate transcription factors.. | |
| Protein Sequence | MKLQQNCDLELRLFPTSYDSDSSDTTSVVESTSSGNPQPNEESQRITIFYNGKMCFSSDVTHLQARSIISIASREMKTKSSSNGSDPPNKSTSFHHNQLPNPKASMKKSLQSFLQKRKIRIQATSPYHSRR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 78 | Phosphorylation | IASREMKTKSSSNGS HHHHHHCCCCCCCCC | 34.54 | 19880383 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIF5A_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIF5A_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIF5A_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MYB21_ARATH | MYB21 | physical | 21447791 | |
| MYB24_ARATH | MYB24 | physical | 21447791 | |
| MYC2_ARATH | MYC2 | physical | 21335373 | |
| MYC3_ARATH | AT5G46760 | physical | 21335373 | |
| MYC4_ARATH | AT4G17880 | physical | 21335373 | |
| WRK57_ARATH | WRKY57 | physical | 24424094 | |
| MYC2_ARATH | MYC2 | physical | 19309455 | |
| TI10A_ARATH | JAZ1 | physical | 19309455 | |
| BH013_ARATH | AT1G01260 | physical | 23935516 | |
| AIB_ARATH | AIB | physical | 23935516 | |
| BH003_ARATH | AT4G16430 | physical | 23935516 | |
| BH014_ARATH | AT4G00870 | physical | 23935516 | |
| MYC2_ARATH | MYC2 | physical | 23632853 | |
| TI10A_ARATH | JAZ1 | physical | 23632853 | |
| NINJA_ARATH | NINJA | physical | 23632853 | |
| TPL_ARATH | TPL | physical | 23632853 | |
| BH028_ARATH | NIG1 | physical | 26002869 | |
| MYC2_ARATH | MYC2 | physical | 25846245 | |
| TPL_ARATH | TPL | physical | 25846245 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
