UniProt ID | TI10A_ARATH | |
---|---|---|
UniProt AC | Q9LMA8 | |
Protein Name | Protein TIFY 10A | |
Gene Name | TIFY10A | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 253 | |
Subcellular Localization | Nucleus . | |
Protein Description | Repressor of jasmonate responses. Jasmonoyl-isoleucine (JA-Ile) specifically promotes COI1-TIFY10A/JAZ1 interaction. Interacts with COI1 and inositol pentakisphosphate to form a high-affinity jasmonates coreceptor.. | |
Protein Sequence | MSSSMECSEFVGSRRFTGKKPSFSQTCSRLSQYLKENGSFGDLSLGMACKPDVNGTLGNSRQPTTTMSLFPCEASNMDSMVQDVKPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKPESQTAPLTIFYAGQVIVFNDFSAEKAKEVINLASKGTANSLAKNQTDIRSNIATIANQVPHPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASSNPQTTGNMSWLGLAAEI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TI10A_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TI10A_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...