UniProt ID | TIF6A_ARATH | |
---|---|---|
UniProt AC | Q58G47 | |
Protein Name | Protein TIFY 6A | |
Gene Name | TIFY6A | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 310 | |
Subcellular Localization | Nucleus . | |
Protein Description | Repressor of jasmonate responses.. | |
Protein Sequence | MERDFLGLGSKLSPITVKEETNEDSAPSRGMMDWSFSSKVGSGPQFLSFGTSQQETRVNTVNDHLLSSAAMDQNQRTYFSSLQEDRVFPGSSQQDQTTITVSMSEPNYINSFINHQHLGGSPIMAPPVSVFPAPTTIRSSSKPLPPQLTIFYAGSVLVYQDIAPEKAQAIMLLAGNGPHAKPVSQPKPQKLVHHSLPTTDPPTMPPSFLPSISYIVSETRSSGSNGVTGLGPTKTKASLASTRNNQTAAFSMAPTVGLPQTRKASLARFLEKRKERVINVSPYYVDNKSSIDCRTLMSECVSCPPAHHLH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
224 | Phosphorylation | SETRSSGSNGVTGLG EECCCCCCCCCCCCC | 32.15 | 24894044 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIF6A_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIF6A_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIF6A_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MYC4_ARATH | AT4G17880 | physical | 21335373 | |
ICE1_ARATH | ICE1 | physical | 23933884 | |
SCRM2_ARATH | SCRM2 | physical | 23933884 | |
WRK57_ARATH | WRKY57 | physical | 24424094 | |
MYC2_ARATH | MYC2 | physical | 19309455 | |
TIF6A_ARATH | JAZ4 | physical | 19309455 | |
TIF7_ARATH | TIFY7 | physical | 19309455 | |
TIF6B_ARATH | JAZ3 | physical | 19309455 | |
BH013_ARATH | AT1G01260 | physical | 23935516 | |
AIB_ARATH | AIB | physical | 23935516 | |
TI10A_ARATH | JAZ1 | physical | 19151223 | |
TIF6B_ARATH | JAZ3 | physical | 19151223 | |
TIF6A_ARATH | JAZ4 | physical | 19151223 | |
TIF5A_ARATH | JAZ8 | physical | 19151223 | |
TIF9_ARATH | JAZ10 | physical | 19151223 | |
TIF3A_ARATH | JAZ11 | physical | 19151223 | |
RAP27_ARATH | RAP2.7 | physical | 26410299 | |
TOE2_ARATH | TOE2 | physical | 26410299 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...