| UniProt ID | THI5_YEAST | |
|---|---|---|
| UniProt AC | P43534 | |
| Protein Name | 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI5 {ECO:0000303|PubMed:23048037} | |
| Gene Name | THI5 {ECO:0000303|Ref.1} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 340 | |
| Subcellular Localization | ||
| Protein Description | Responsible for the formation of the pyrimidine heterocycle in the thiamine biosynthesis pathway. Catalyzes the formation of hydroxymethylpyrimidine phosphate (HMP-P) from histidine and pyridoxal phosphate (PLP). The protein uses PLP and the active site histidine to form HMP-P, generating an inactive enzyme. The enzyme can only undergo a single turnover, which suggests it is a suicide enzyme.. | |
| Protein Sequence | MSTDKITFLLNWQPTPYHIPIFLAQTKGYFKEQGLDMAILEPTNPSDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVASLLDEPFTGVLYLKGSGITEDFQSLKGKKIGYVGEFGKIQIDELTKHYGMKPEDYTAVRCGMNVAKYIIEGKIDAGIGIECMQQVELEEYLAKQGRPASDAKMLRIDKLACLGCCCFCTVLYICNDEFLKKNPEKVRKFLKAIKKATDYVLADPVKAWKEYIDFKPQLNNDLSYKQYQRCYAYFSSSLYNVHRDWKKVTGYGKRLAILPPDYVSNYTNEYLSWPEPEEVSDPLEAQRLMAIHQEKCRQEGTFKRLALPA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 62 | N6-(pyridoxal phosphate)lysine | GKVDMGLKAMIHTLA CCCCHHHHHHHHHHH | 30.13 | - | |
| 62 | Other | GKVDMGLKAMIHTLA CCCCHHHHHHHHHHH | 30.13 | 23048037 | |
| 280 | Phosphorylation | HRDWKKVTGYGKRLA HCCHHHHCCCCCEEE | 33.30 | 30377154 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of THI5_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of THI5_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of THI5_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| THI5_YEAST | THI5 | physical | 23048037 | |
| SCC1_YEAST | MCD1 | genetic | 27708008 | |
| SHE1_YEAST | SHE1 | genetic | 27708008 | |
| SWC5_YEAST | SWC5 | genetic | 27708008 | |
| MRM2_YEAST | MRM2 | genetic | 27708008 | |
| RPB1_YEAST | RPO21 | genetic | 27708008 | |
| TCPD_YEAST | CCT4 | genetic | 27708008 | |
| PRP19_YEAST | PRP19 | genetic | 27708008 | |
| TYSY_YEAST | CDC21 | genetic | 27708008 | |
| SWD1_YEAST | SWD1 | genetic | 27708008 | |
| ATG8_YEAST | ATG8 | genetic | 27708008 | |
| MAF1_YEAST | MAF1 | genetic | 27708008 | |
| IF4A_YEAST | TIF2 | genetic | 27708008 | |
| MDM35_YEAST | MDM35 | genetic | 27708008 | |
| MGR3_YEAST | MGR3 | genetic | 27708008 | |
| CTU2_YEAST | NCS2 | genetic | 27708008 | |
| NOP12_YEAST | NOP12 | genetic | 27708008 | |
| RU2A_YEAST | LEA1 | genetic | 27708008 | |
| YAR1_YEAST | YAR1 | genetic | 27708008 | |
| YME1_YEAST | YME1 | genetic | 27708008 | |
| UBA3_YEAST | UBA3 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
