dbPTM

RSM18_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RSM18_YEAST
UniProt AC	P40033
Protein Name	37S ribosomal protein RSM18, mitochondrial
Gene Name	RSM18
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	138
Subcellular Localization	Mitochondrion . Mitoribosomes are tethered to the mitochondrial inner membrane and spatially aligned with the membrane insertion machinery through two distinct membrane contact sites, formed by the 21S rRNA expansion segment 96-ES1 and the inner memb
Protein Description	Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane..
Protein Sequence	MQPIIKGAVSSTFKRALYNFGIKEKKSVNIEMGRTQQTKKIDQSLSKKLPKGTIYDPFDFSMGRIHLDRKYQANKNSNRNDIMKSGANPLEFYARPRILSRYVTSTGRIQHRDITGLSAKNQRRLSKAIRRCQAIGLM

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
85	Phosphorylation	NRNDIMKSGANPLEF CHHHHHHCCCCHHHH	26.26	22369663
93	Phosphorylation	GANPLEFYARPRILS CCCHHHHHCCHHHHH	7.73	22369663

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RSM18_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RSM18_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RSM18_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RT09_YEAST	MRPS9	physical	16554755
RT05_YEAST	MRPS5	physical	16554755
RT10_YEAST	RSM10	physical	16554755
RT24_YEAST	RSM24	physical	16554755
CYPD_YEAST	CPR5	physical	16554755
RT28_YEAST	MRPS28	physical	16554755
RT01_YEAST	MRP1	physical	16554755
YRA1_YEAST	YRA1	physical	16554755
RSM28_YEAST	RSM28	physical	16554755
RT23_YEAST	RSM23	physical	16554755
RT13_YEAST	MRP13	physical	16554755
RT35_YEAST	MRPS35	physical	16554755
RT27_YEAST	RSM27	physical	16554755
RT04_YEAST	MRP4	physical	16554755
LSM12_YEAST	LSM12	physical	16554755
IMDH2_YEAST	IMD2	physical	16554755
MAM33_YEAST	MAM33	physical	16554755
RT25_YEAST	RSM25	physical	16554755
GEA1_YEAST	GEA1	physical	16554755
RT26_YEAST	RSM26	physical	16554755
RT07_YEAST	RSM7	physical	16554755
DEF1_YEAST	DEF1	physical	16554755
RT22_YEAST	RSM22	physical	16554755
IMDH3_YEAST	IMD3	physical	16554755
RT08_YEAST	MRPS8	physical	16554755
HAS1_YEAST	HAS1	physical	16554755
SWS2_YEAST	SWS2	physical	16554755
NAM9_YEAST	NAM9	physical	16554755
CSK22_YEAST	CKA2	physical	16554755
RTPT_YEAST	PET123	physical	16554755
RT16_YEAST	MRPS16	physical	16554755
RT51_YEAST	MRP51	physical	16554755

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RSM18_YEAST

Related Literatures of Post-Translational Modification