RT10_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RT10_YEAST
• UniProt AC: Q03201
• Protein Name: 37S ribosomal protein S10, mitochondrial
• Gene Name: RSM10
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 203
• Subcellular Localization: Mitochondrion . Mitoribosomes are tethered to the mitochondrial inner membrane and spatially aligned with the membrane insertion machinery through two distinct membrane contact sites, formed by the 21S rRNA expansion segment 96-ES1 and the inner memb
• Protein Description: Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane..
• Protein Sequence: MLRNTIALRSFIRTQSTRPYPVNVEAVYYAPLKLPIKYGDLVADIQLRSYDNENLDFYSDFILRTGYYLGIPLTGPKPLPTRRERWTVIKSPFVHAKSKENFERHTHKRLIRAWDTNPEVLQMLIAYITKHSMAGVGMKCNFFQRSEISLDLGSDANGLEKSLSNIDELYSLRNDDKAQTSAVGQKVLELLDSPDFKKHLEKK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
162	Phosphorylation	DANGLEKSLSNIDEL CCCCHHHHHHCHHHH	27.88	30377154
164	Phosphorylation	NGLEKSLSNIDELYS CCHHHHHHCHHHHHH	38.54	21551504
193	Phosphorylation	KVLELLDSPDFKKHL HHHHHHCCHHHHHHH	26.74	22369663

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RT10_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RT10_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RT10_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HIBCH_YEAST	EHD3	physical	16429126
RT01_YEAST	MRP1	physical	16429126
RT13_YEAST	MRP13	physical	16429126
RT04_YEAST	MRP4	physical	16429126
RT51_YEAST	MRP51	physical	16429126
RT17_YEAST	MRPS17	physical	16429126
RT18_YEAST	MRPS18	physical	16429126
RT28_YEAST	MRPS28	physical	16429126
RT09_YEAST	MRPS9	physical	16429126
NAM9_YEAST	NAM9	physical	16429126
RT22_YEAST	RSM22	physical	16429126
RT23_YEAST	RSM23	physical	16429126
RT26_YEAST	RSM26	physical	16429126
RT07_YEAST	RSM7	physical	16429126
DED1_YEAST	DED1	physical	16429126

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"A multidimensional chromatography technology for in-depthphosphoproteome analysis.";
Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.;
Mol. Cell. Proteomics 7:1389-1396(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-193, AND MASSSPECTROMETRY.
PubMed: 18407956