| UniProt ID | RMD6_YEAST | |
|---|---|---|
| UniProt AC | P39975 | |
| Protein Name | Sporulation protein RMD6 | |
| Gene Name | RMD6 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 231 | |
| Subcellular Localization | ||
| Protein Description | Required for sporulation. Required for meiotic nuclear division.. | |
| Protein Sequence | MSACPCNIVILPVEILKNSSKDTKYSLYTTINRGYDVPRLKYGIIVSPRVHSLETLFSDLGFDKNIEKSSLYLLLNDPTLAYPNFHEHFEQLKGETNKDLSLPTYYIPKVQFLTEAFDSEHTLATIGYKPNNKESYEITGFTSMGNGYGIKLFNYSVIHMMRSHKCKRVVADIIMEHDLLGYYEKKLGFVEVQRFKVLKEQHQVKVFDDKVDFTKDFHVIKMIKELGNHRL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 52 | Phosphorylation | IVSPRVHSLETLFSD EEECCCCCHHHHHHH | 25.66 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RMD6_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RMD6_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RMD6_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RDS1_YEAST | RDS1 | physical | 18719252 | |
| SWI6_YEAST | SWI6 | genetic | 27708008 | |
| PSB3_YEAST | PUP3 | genetic | 27708008 | |
| COG3_YEAST | COG3 | genetic | 27708008 | |
| MPPA_YEAST | MAS2 | genetic | 27708008 | |
| EXO70_YEAST | EXO70 | genetic | 27708008 | |
| NSE1_YEAST | NSE1 | genetic | 27708008 | |
| NEP1_YEAST | EMG1 | genetic | 27708008 | |
| SC61A_YEAST | SEC61 | genetic | 27708008 | |
| CDC91_YEAST | GAB1 | genetic | 27708008 | |
| ORC1_YEAST | ORC1 | genetic | 27708008 | |
| RNA1_YEAST | RNA1 | genetic | 27708008 | |
| NOP2_YEAST | NOP2 | genetic | 27708008 | |
| YHK5_YEAST | YHR045W | genetic | 27708008 | |
| ELM1_YEAST | ELM1 | genetic | 27708008 | |
| RL22A_YEAST | RPL22A | genetic | 27708008 | |
| BUD21_YEAST | BUD21 | genetic | 27708008 | |
| MRX11_YEAST | YPL041C | genetic | 27708008 | |
| CG12_YEAST | CLN2 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...