UniProt ID | RMD6_YEAST | |
---|---|---|
UniProt AC | P39975 | |
Protein Name | Sporulation protein RMD6 | |
Gene Name | RMD6 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 231 | |
Subcellular Localization | ||
Protein Description | Required for sporulation. Required for meiotic nuclear division.. | |
Protein Sequence | MSACPCNIVILPVEILKNSSKDTKYSLYTTINRGYDVPRLKYGIIVSPRVHSLETLFSDLGFDKNIEKSSLYLLLNDPTLAYPNFHEHFEQLKGETNKDLSLPTYYIPKVQFLTEAFDSEHTLATIGYKPNNKESYEITGFTSMGNGYGIKLFNYSVIHMMRSHKCKRVVADIIMEHDLLGYYEKKLGFVEVQRFKVLKEQHQVKVFDDKVDFTKDFHVIKMIKELGNHRL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
52 | Phosphorylation | IVSPRVHSLETLFSD EEECCCCCHHHHHHH | 25.66 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RMD6_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RMD6_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RMD6_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RDS1_YEAST | RDS1 | physical | 18719252 | |
SWI6_YEAST | SWI6 | genetic | 27708008 | |
PSB3_YEAST | PUP3 | genetic | 27708008 | |
COG3_YEAST | COG3 | genetic | 27708008 | |
MPPA_YEAST | MAS2 | genetic | 27708008 | |
EXO70_YEAST | EXO70 | genetic | 27708008 | |
NSE1_YEAST | NSE1 | genetic | 27708008 | |
NEP1_YEAST | EMG1 | genetic | 27708008 | |
SC61A_YEAST | SEC61 | genetic | 27708008 | |
CDC91_YEAST | GAB1 | genetic | 27708008 | |
ORC1_YEAST | ORC1 | genetic | 27708008 | |
RNA1_YEAST | RNA1 | genetic | 27708008 | |
NOP2_YEAST | NOP2 | genetic | 27708008 | |
YHK5_YEAST | YHR045W | genetic | 27708008 | |
ELM1_YEAST | ELM1 | genetic | 27708008 | |
RL22A_YEAST | RPL22A | genetic | 27708008 | |
BUD21_YEAST | BUD21 | genetic | 27708008 | |
MRX11_YEAST | YPL041C | genetic | 27708008 | |
CG12_YEAST | CLN2 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...