| UniProt ID | RAC11_ARATH | |
|---|---|---|
| UniProt AC | P92978 | |
| Protein Name | Rac-like GTP-binding protein ARAC11 | |
| Gene Name | ARAC11 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 197 | |
| Subcellular Localization |
Cytoplasm. Membrane Peripheral membrane protein. Associated with the membrane when activated. |
|
| Protein Description | May be involved in cell polarity control during the actin-dependent tip growth of pollen tubes. May regulate callose synthase 1 (CALS1) activity through the interaction with UGT1.; Inactive GDP-bound Rho GTPases reside in the cytosol, are found in a complex with Rho GDP-dissociation inhibitors (Rho GDIs), and are released from the GDI protein in order to translocate to membranes upon activation.. | |
| Protein Sequence | MSASRFVKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGAVPITTAQGEELRKQIGAPTYIECSSKTQENVKAVFDAAIRVVLQPPKQKKKKSKAQKACSIL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSASRFVKC ------CCHHHCEEE | 34.64 | 26091701 | |
| 4 | Phosphorylation | ----MSASRFVKCVT ----CCHHHCEEEEE | 20.95 | 26091701 | |
| 11 | Phosphorylation | SRFVKCVTVGDGAVG HHCEEEEEECCCCCC | 28.39 | 26091701 | |
| 194 | Geranylgeranylation | KSKAQKACSIL---- CHHHHHHHHCC---- | 3.15 | - | |
| 194 | Methylation | KSKAQKACSIL---- CHHHHHHHHCC---- | 3.15 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAC11_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAC11_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAC11_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| U75B1_ARATH | UGT75B1 | physical | 11283335 | |
| RIC3_ARATH | RIC3 | physical | 15824136 | |
| RIC4_ARATH | RIC4 | physical | 15824136 | |
| ICR1_ARATH | ICR1 | physical | 19825600 | |
| ICR4_ARATH | RIP2 | physical | 19825600 | |
| ICR2_ARATH | RIP3 | physical | 19825600 | |
| ICR5_ARATH | RIP4 | physical | 19825600 | |
| ICR3_ARATH | RIP5 | physical | 19825600 | |
| KAT3_ARATH | KAT3 | physical | 15299147 | |
| ICR5_ARATH | RIP4 | physical | 20832900 | |
| RGAP1_ARATH | AT5G22400 | physical | 11115880 | |
| RGAP2_ARATH | AT4G03100 | physical | 11115880 | |
| RGAP3_ARATH | AT2G46710 | physical | 11115880 | |
| RIC1_ARATH | RIC1 | physical | 11752391 | |
| RIC4_ARATH | RIC4 | physical | 11752391 | |
| RIC2_ARATH | RIC2 | physical | 11752391 | |
| RIC6_ARATH | RIC6 | physical | 11752391 | |
| RIC9_ARATH | AT1G61795 | physical | 11752391 | |
| RIC5_ARATH | RIC5 | physical | 11752391 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
