UniProt ID | RAC11_ARATH | |
---|---|---|
UniProt AC | P92978 | |
Protein Name | Rac-like GTP-binding protein ARAC11 | |
Gene Name | ARAC11 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 197 | |
Subcellular Localization |
Cytoplasm. Membrane Peripheral membrane protein. Associated with the membrane when activated. |
|
Protein Description | May be involved in cell polarity control during the actin-dependent tip growth of pollen tubes. May regulate callose synthase 1 (CALS1) activity through the interaction with UGT1.; Inactive GDP-bound Rho GTPases reside in the cytosol, are found in a complex with Rho GDP-dissociation inhibitors (Rho GDIs), and are released from the GDI protein in order to translocate to membranes upon activation.. | |
Protein Sequence | MSASRFVKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGAVPITTAQGEELRKQIGAPTYIECSSKTQENVKAVFDAAIRVVLQPPKQKKKKSKAQKACSIL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSASRFVKC ------CCHHHCEEE | 34.64 | 26091701 | |
4 | Phosphorylation | ----MSASRFVKCVT ----CCHHHCEEEEE | 20.95 | 26091701 | |
11 | Phosphorylation | SRFVKCVTVGDGAVG HHCEEEEEECCCCCC | 28.39 | 26091701 | |
194 | Geranylgeranylation | KSKAQKACSIL---- CHHHHHHHHCC---- | 3.15 | - | |
194 | Methylation | KSKAQKACSIL---- CHHHHHHHHCC---- | 3.15 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAC11_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAC11_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAC11_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
U75B1_ARATH | UGT75B1 | physical | 11283335 | |
RIC3_ARATH | RIC3 | physical | 15824136 | |
RIC4_ARATH | RIC4 | physical | 15824136 | |
ICR1_ARATH | ICR1 | physical | 19825600 | |
ICR4_ARATH | RIP2 | physical | 19825600 | |
ICR2_ARATH | RIP3 | physical | 19825600 | |
ICR5_ARATH | RIP4 | physical | 19825600 | |
ICR3_ARATH | RIP5 | physical | 19825600 | |
KAT3_ARATH | KAT3 | physical | 15299147 | |
ICR5_ARATH | RIP4 | physical | 20832900 | |
RGAP1_ARATH | AT5G22400 | physical | 11115880 | |
RGAP2_ARATH | AT4G03100 | physical | 11115880 | |
RGAP3_ARATH | AT2G46710 | physical | 11115880 | |
RIC1_ARATH | RIC1 | physical | 11752391 | |
RIC4_ARATH | RIC4 | physical | 11752391 | |
RIC2_ARATH | RIC2 | physical | 11752391 | |
RIC6_ARATH | RIC6 | physical | 11752391 | |
RIC9_ARATH | AT1G61795 | physical | 11752391 | |
RIC5_ARATH | RIC5 | physical | 11752391 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...