UniProt ID | RIC3_ARATH | |
---|---|---|
UniProt AC | F4I5N6 | |
Protein Name | CRIB domain-containing protein RIC3 | |
Gene Name | RIC3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 220 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Functions as downstream effector of Rho-related GTP binding proteins of the "Rho of Plants" (ROPs) family. Participates in the propagation of ROP GTPase signals in specific cellular responses. Functions as downstream effector of ARAC11/ROP1 to activate calcium signaling that leads to F-actin disassembly associated with exocytosis in the tip of the growing pollen tube. Counteracts the ARAC11/ROP1-RIC4 pathway, which promotes apical F-actin assembly associated with vesicle accumulation, to control actin dynamics and pollen tube apical growth.. | |
Protein Sequence | MATVKGLLKGLRYITQIFDEEKDKDMQIGFPTDVKHVAHIGSDGPATNVPSWMGDFKPQENENGQVVSRADANNNQIGEGVGLQELLPPTDKPKHKKTRRKSETVSQNGSPPRRNSSASASDMQPKNTRRHHRSRHGSIDSSNDPSVRRRRVVSVTTNDMEGSYPLSDSSTHSRKSTSRHRKPKGSGGGELSMKKTKGKTENPIVESVDTCNDNNISDKE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
32 | Phosphorylation | DMQIGFPTDVKHVAH CCCCCCCCCCCEEEE | 19880383 | ||
138 | Phosphorylation | HHRSRHGSIDSSNDP CHHHHCCCCCCCCCH | 19880383 | ||
186 | Phosphorylation | RHRKPKGSGGGELSM CCCCCCCCCCCCCCE | 19376835 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RIC3_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RIC3_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RIC3_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RIC3_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...