UniProt ID | RIC1_ARATH | |
---|---|---|
UniProt AC | F4IVV0 | |
Protein Name | CRIB domain-containing protein RIC1 | |
Gene Name | RIC1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 224 | |
Subcellular Localization | Cytoplasm, cytoskeleton . Cytoplasm . Associates with and promotes the organization of cortical microtubules in leaf epidermal pavement cells. Localizes to punctate loci in the cytoplasm of root cells. | |
Protein Description | Functions as downstream effector of Rho-related GTP binding proteins of the "Rho of Plants" (ROPs) family. Participates in the propagation of ROP GTPase signals in specific cellular responses. Required for cortical microtubule organization. Promotes microtubule bundling and formation of well-ordered microtubule arrays in the neck region of pavement cells. This restricts cell lateral expansion to generate the narrow neck morphology of pavement cells. Its function is inhibited when it interacts with activated ARAC4/ROP2. Represses ARAC4/ROP2 activation and antagonizes the RIC4-actin pathway that promotes the assembly of cortical actin microfilaments. Acts as downstream effector of ARAC3/ROP6 which functions in a signaling pathway that negatively regulates clathrin-mediated endocytosis and internalization of PIN1 and PIN2. Required for the asymmetric auxin distribution during root gravitropism and vascular patterning. Positively regulates auxin responses, but negatively regulates ABA responses during lateral root development and primary root elongation.. | |
Protein Sequence | MATTMKGLLKGLRYITQIFDEEKEQEMQIGFPTDVKHVAHIGSDGPTNTTPSWMNDFKTQEHEKGQVVSRGNSNKYNPQGTNQRGAGLKELLPSNTNEKPKQKTRRKPGGAASPNHNGSPPRKSSGNAASSDEPSKHSRHNRSAHGSTDSSNDQEPSVRRRRGGIPAPDTEVPNQIPDGSAPPRKATSRPRKLKGSSAGGEGSIKKSSKGKPENSVDTTCNDII | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of RIC1_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RIC1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RIC1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RIC1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ICR1_ARATH | ICR1 | physical | 19825600 | |
RAC3_ARATH | RAC3 | physical | 19818614 | |
KTNA1_ARATH | ERH3 | physical | 23394835 | |
RAC4_ARATH | ROP2 | physical | 18308939 | |
RAC1_ARATH | ARAC1 | physical | 18308939 | |
RAC5_ARATH | ARAC5 | physical | 18308939 | |
RAC6_ARATH | RAC6 | physical | 18308939 | |
RAC3_ARATH | RAC3 | physical | 18308939 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...