RAC1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAC1_ARATH
• UniProt AC: Q38902
• Protein Name: Rac-like GTP-binding protein ARAC1
• Gene Name: ARAC1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 197
• Subcellular Localization: Cytoplasm. Membrane; Peripheral membrane protein. Associated with the membrane when activated.
• Protein Description: Inactive GDP-bound Rho GTPases reside in the cytosol, are found in a complex with Rho GDP-dissociation inhibitors (Rho GDIs), and are released from the GDI protein in order to translocate to membranes upon activation..
• Protein Sequence: MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGAVPITTAQGEELKKLIGAPAYIECSSKTQENVKGVFDAAIRVVLQPPKQKKKKSKAQKACSIL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
194	Geranylgeranylation	KSKAQKACSIL---- CHHHHHHHHCC----	3.15	-
194	Methylation	KSKAQKACSIL---- CHHHHHHHHCC----	3.15	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAC1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAC1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAC1_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RAC1_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.