dbPTM

RAC5_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RAC5_ARATH
UniProt AC	Q38937
Protein Name	Rac-like GTP-binding protein ARAC5
Gene Name	ARAC5
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	196
Subcellular Localization	Cytoplasm . Membrane Peripheral membrane protein . Associated with the membrane when activated.
Protein Description	May be involved in cell polarity control during the actin-dependent tip growth of root hairs.; Inactive GDP-bound Rho GTPases reside in the cytosol, are found in a complex with Rho GDP-dissociation inhibitors (Rho GDIs), and are released from the GDI protein in order to translocate to membranes upon activation..
Protein Sequence	MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGAVPITTNQGEELKKLIGSPIYIECSSKTQQNVKAVFDAAIKVVLQPPKQKKKKKNKNRCVFL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
193	Geranylgeranylation	KKKNKNRCVFL---- CCCCCCCCCCC----	3.38	-
193	Methylation	KKKNKNRCVFL---- CCCCCCCCCCC----	3.38	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RAC5_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RAC5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RAC5_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GDIR_ARATH	SCN1	physical	10798620
RBK1_ARATH	RBK1	physical	18088316
RBK2_ARATH	RBK2	physical	18088316
NCRK_ARATH	NCRK	physical	18088316

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RAC5_ARATH

Related Literatures of Post-Translational Modification