ICR1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ICR1_ARATH
• UniProt AC: Q8LE98
• Protein Name: Interactor of constitutive active ROPs 1
• Gene Name: ICR1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 344
• Subcellular Localization: Cell membrane ; Peripheral membrane protein. Nucleus . The localization of the ICR1-ROP complexes at the plasma membrane depend on the lipid modifications of the ROPs (PubMed:17493810). Localized in the nuclei in mature pollen, then shifts to the sit
• Protein Description: Acts as a scaffold, mediating interaction of ROPs with different proteins. Required for primary and adventitious root maintenance, but not for their formation. Promotes the stabilization of ARAC11 on the plasma membrane of the pollen tube initiation site but not the activation of ARAC11. Regulates directionality of polar auxin transport, and is required for the formation of a stable auxin maximum and tip localized auxin gradient during embryogenesis, organogenesis, and meristem activity. Involved in exocytosis and in the recycling of PIN proteins back to the plasma membrane..
• Protein Sequence: MPRPRVSELSQRQAPRLRSSSSTSDSNHSNRLITTDQSFKPGVDRKSPRSGGPNSDPLGQKKLGGRISDLESQLGQAQEELRLLKEQLANAEAVKKQAQDELHKKSKKPNPLARVEESATEAERIDRDEIPGDVQKETDVFEVPVEKIAVEEEELRSGNDEAEKLVAKEDEIKMLKARLYDMEKEHESLGKENESLKNQLSDSASEISNVKANEDEMVSKVSRIGEELEESRAKTAHLKEKLESMEEAKDALEAEMKKLRVQTEQWRKAADAAAAVLSGEFEMNGRDRSGSTEKYYAGGFFDPSAGFMDPPGMADDYDDGLGSGKRKSSGMKMFGELWRKKGQK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
34	Phosphorylation	NHSNRLITTDQSFKP CCCCCEEECCCCCCC	28.98	25561503
35	Phosphorylation	HSNRLITTDQSFKPG CCCCEEECCCCCCCC	25.66	25561503
38	Phosphorylation	RLITTDQSFKPGVDR CEEECCCCCCCCCCC	37.74	25561503
68	Phosphorylation	KKLGGRISDLESQLG HHHCCCHHHHHHHHH	34.48	30291188
72	Phosphorylation	GRISDLESQLGQAQE CCHHHHHHHHHHHHH	37.69	23660473
157	Phosphorylation	VEEEELRSGNDEAEK CCHHHHHCCCHHHHH	55.35	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ICR1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ICR1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ICR1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RAC11_ARATH	ROP1	physical	19825600
SEC3A_ARATH	SEC3A	physical	20832900
VAR3_ARATH	VAR3	physical	25768119

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.