RAC6_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAC6_ARATH
• UniProt AC: Q9SBJ6
• Protein Name: Rac-like GTP-binding protein ARAC6
• Gene Name: ARAC6
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 197
• Subcellular Localization: Cytoplasm. Membrane; Peripheral membrane protein. Associated with the membrane when activated.
• Protein Description: May be involved in cell polarity control during the actin-dependent tip growth of pollen tubes.; Inactive GDP-bound Rho GTPases reside in the cytosol, are found in a complex with Rho GDP-dissociation inhibitors (Rho GDIs), and are released from the GDI protein in order to translocate to membranes upon activation..
• Protein Sequence: MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGAVPITTVQGEELKKLIGAPAYIECSSKSQENVKGVFDAAIRVVLQPPKQKKKKNKAQKACSIL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
194	Geranylgeranylation	KNKAQKACSIL---- CCHHHHHHHCC----	3.15	-
194	Methylation	KNKAQKACSIL---- CCHHHHHHHCC----	3.15	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAC6_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAC6_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAC6_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CBSX1_ARATH	LEJ2	physical	21798944
M2K10_ARATH	MKK10	physical	21423366
RPKL_ARATH	AT4G34220	physical	21423366
SRF2_ARATH	SRF2	physical	21423366
C83A1_ARATH	CYP83A1	physical	21423366
Y4052_ARATH	AT4G30520	physical	21423366
Y3037_ARATH	AT3G03770	physical	21423366
Y4372_ARATH	AT4G37250	physical	21423366
Y4312_ARATH	AT4G31250	physical	21423366
P2C16_ARATH	HAB1	physical	21423366
ACA12_ARATH	AT3G63380	physical	21423366
SERK2_ARATH	SERK2	physical	21423366
SERK1_ARATH	SERK1	physical	21423366
Y4245_ARATH	AT4G20450	physical	21423366
HA22J_ARATH	HVA22J	physical	21423366
GCR1_ARATH	GCR1	physical	21423366
Y2289_ARATH	AT2G28960	physical	21423366
MLO2_ARATH	MLO2	physical	21423366

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.