| UniProt ID | C83A1_ARATH | |
|---|---|---|
| UniProt AC | P48421 | |
| Protein Name | Cytochrome P450 83A1 | |
| Gene Name | CYP83A1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 502 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein . |
|
| Protein Description | Involved in the metabolism of aliphatic and aromatic oximes. [PubMed: 12970475 Involved in the biosynthesis of both short-chain and long-chain aliphatic glucosinolates] | |
| Protein Sequence | MEDIIIGVVALAAVLLFFLYQKPKTKRYKLPPGPSPLPVIGNLLQLQKLNPQRFFAGWAKKYGPILSYRIGSRTMVVISSAELAKELLKTQDVNFADRPPHRGHEFISYGRRDMALNHYTPYYREIRKMGMNHLFSPTRVATFKHVREEEARRMMDKINKAADKSEVVDISELMLTFTNSVVCRQAFGKKYNEDGEEMKRFIKILYGTQSVLGKIFFSDFFPYCGFLDDLSGLTAYMKECFERQDTYIQEVVNETLDPKRVKPETESMIDLLMGIYKEQPFASEFTVDNVKAVILDIVVAGTDTAAAAVVWGMTYLMKYPQVLKKAQAEVREYMKEKGSTFVTEDDVKNLPYFRALVKETLRIEPVIPLLIPRACIQDTKIAGYDIPAGTTVNVNAWAVSRDEKEWGPNPDEFRPERFLEKEVDFKGTDYEFIPFGSGRRMCPGMRLGAAMLEVPYANLLLSFNFKLPNGMKPDDINMDVMTGLAMHKSQHLKLVPEKVNKY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of C83A1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of C83A1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of C83A1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of C83A1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MSBP1_ARATH | MSBP1 | physical | 24833385 | |
| UBC34_ARATH | UBC34 | physical | 24833385 | |
| CNIH1_ARATH | AT3G12180 | physical | 24833385 | |
| MSBP2_ARATH | MAPR3 | physical | 24833385 | |
| PPA3_ARATH | PAP3 | physical | 24833385 | |
| WAK3_ARATH | WAK3 | physical | 24833385 | |
| PAM74_ARATH | AT5G59650 | physical | 24833385 | |
| BETL2_ARATH | AT1G29060 | physical | 24833385 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
