| UniProt ID | MSBP1_ARATH | |
|---|---|---|
| UniProt AC | Q9XFM6 | |
| Protein Name | Membrane steroid-binding protein 1 | |
| Gene Name | MSBP1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 220 | |
| Subcellular Localization |
Cell membrane Single-pass type II membrane protein . Endosome membrane Single-pass type II membrane protein . |
|
| Protein Description | MSBP1 can bind to multiple steroid compounds with different affinities. Negatively regulates cell elongation and brassinosteroid signaling. May act as a coreceptor with BAK1 and enhances its endocytosis.. | |
| Protein Sequence | MALELWQTLKEAIHAYTGLSPVVFFTALALAFAIYQVISGWFASPFDDVNRHQRARSLAQEEEPPIPQPVQVGEITEEELKQYDGSDPQKPLLMAIKHQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFEEKDLTWDVSGLGPFELDALQDWEYKFMSKYAKVGTVKVAGSEPETASVSEPTENVEQDAHVTTTPGKTVVDKSDDAPAETVLKKEE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 57 | Phosphorylation | NRHQRARSLAQEEEP CHHHHHHHHHHCCCC | 27.37 | 23111157 | |
| 122 | Ubiquitination | PYALFAGKDASRALA CCEEEECHHHHHHHH | 46.84 | - | |
| 130 | Ubiquitination | DASRALAKMSFEEKD HHHHHHHHCCCCCCC | 35.61 | - | |
| 166 | Ubiquitination | KFMSKYAKVGTVKVA HHHHHCCCEEEEEEC | 37.80 | - | |
| 175 | Phosphorylation | GTVKVAGSEPETASV EEEEECCCCCCCCCC | 39.99 | 23776212 | |
| 179 | Phosphorylation | VAGSEPETASVSEPT ECCCCCCCCCCCCCC | 34.64 | 23776212 | |
| 181 | Phosphorylation | GSEPETASVSEPTEN CCCCCCCCCCCCCCC | 33.33 | 23776212 | |
| 183 | Phosphorylation | EPETASVSEPTENVE CCCCCCCCCCCCCCC | 35.05 | 23776212 | |
| 186 | Phosphorylation | TASVSEPTENVEQDA CCCCCCCCCCCCCCC | 35.82 | 23776212 | |
| 196 | Phosphorylation | VEQDAHVTTTPGKTV CCCCCEEECCCCCEE | 18.32 | 23776212 | |
| 197 | Phosphorylation | EQDAHVTTTPGKTVV CCCCEEECCCCCEEE | 29.88 | 23776212 | |
| 198 | Phosphorylation | QDAHVTTTPGKTVVD CCCEEECCCCCEEEE | 22.22 | 23776212 | |
| 207 | Phosphorylation | GKTVVDKSDDAPAET CCEEEECCCCCCHHH | 35.94 | 19880383 | |
| 217 | Ubiquitination | APAETVLKKEE---- CCHHHHCCCCC---- | 54.53 | - | |
| 218 | Ubiquitination | PAETVLKKEE----- CHHHHCCCCC----- | 64.02 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MSBP1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MSBP1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MSBP1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| UBQ10_ARATH | UBQ10 | physical | 22513011 | |
| BAK1_ARATH | BAK1 | physical | 19532123 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
