UniProt ID | M2K10_ARATH | |
---|---|---|
UniProt AC | Q9LQM8 | |
Protein Name | Mitogen-activated protein kinase kinase 10 | |
Gene Name | MKK10 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 305 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MTLVRERRHQEPLTLSIPPLIYHGTAFSVASSSSSSPETSPIQTLNDLEKLSVLGQGSGGTVYKTRHRRTKTLYALKVLRPNLNTTVTVEADILKRIESSFIIKCYAVFVSLYDLCFVMELMEKGSLHDALLAQQVFSEPMVSSLANRILQGLRYLQKMGIVHGDIKPSNLLINKKGEVKIADFGASRIVAGGDYGSNGTCAYMSPERVDLEKWGFGGEVGFAGDVWSLGVVVLECYIGRYPLTKVGDKPDWATLFCAICCNEKVDIPVSCSLEFRDFVGRCLEKDWRKRDTVEELLRHSFVKNR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of M2K10_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of M2K10_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of M2K10_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
P2C16_ARATH | HAB1 | physical | 21423366 | |
C85A2_ARATH | BR6OX2 | physical | 24833385 | |
CNIH1_ARATH | AT3G12180 | physical | 24833385 | |
WAK3_ARATH | WAK3 | physical | 24833385 | |
PAM74_ARATH | AT5G59650 | physical | 24833385 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...