ICR4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ICR4_ARATH
• UniProt AC: Q9M9F9
• Protein Name: Interactor of constitutive active ROPs 4
• Gene Name: ICR4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 324
• Protein Description: Acts as a scaffold, mediating interaction of ROPs with different proteins..
• Protein Sequence: MPKPSIRGSELPQRQSPRLRTSLLSTSSDPHHLSRPITDRSPKLGLDRRSPRSGGPHTDPLSQKKLGSRISGLESQLGQAQEELRLLKQQLAKAEAAKKRAQEELHRKKSKKPNTPAPERDDIPGDGHQETDVFEVLDEKAKESEKTKNDELASKEDQINVLKARLYDLEKERVSLSEENETLKDQLKKTDTEMSCAKAKEDEIASKVSQIGEELEESNETTAKLKKKLESVEEAKETLEAEMKKLKVQTEQWRKAADAAAAVLSGGVEMNGRFSEQCGSMEKHFAGRFVGSPGMADDSDDGSGKRKSSGKKMFGDLWKKKGQK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16	Phosphorylation	SELPQRQSPRLRTSL CCCCCCCCCHHHHHH	17.74	29654922
41	Phosphorylation	SRPITDRSPKLGLDR CCCCCCCCCCCCCCC	29.24	25561503
231	Phosphorylation	KLKKKLESVEEAKET HHHHHHHHHHHHHHH	45.31	24894044
292	Phosphorylation	FAGRFVGSPGMADDS CCCCCCCCCCCCCCC	16.99	30291188
299	Phosphorylation	SPGMADDSDDGSGKR CCCCCCCCCCCCCCC	37.84	23776212
303	Phosphorylation	ADDSDDGSGKRKSSG CCCCCCCCCCCCCCC	48.40	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ICR4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ICR4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ICR4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KN13A_ARATH	KINESIN-13A	physical	20832900

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.