UniProt ID | ICR4_ARATH | |
---|---|---|
UniProt AC | Q9M9F9 | |
Protein Name | Interactor of constitutive active ROPs 4 | |
Gene Name | ICR4 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 324 | |
Subcellular Localization | ||
Protein Description | Acts as a scaffold, mediating interaction of ROPs with different proteins.. | |
Protein Sequence | MPKPSIRGSELPQRQSPRLRTSLLSTSSDPHHLSRPITDRSPKLGLDRRSPRSGGPHTDPLSQKKLGSRISGLESQLGQAQEELRLLKQQLAKAEAAKKRAQEELHRKKSKKPNTPAPERDDIPGDGHQETDVFEVLDEKAKESEKTKNDELASKEDQINVLKARLYDLEKERVSLSEENETLKDQLKKTDTEMSCAKAKEDEIASKVSQIGEELEESNETTAKLKKKLESVEEAKETLEAEMKKLKVQTEQWRKAADAAAAVLSGGVEMNGRFSEQCGSMEKHFAGRFVGSPGMADDSDDGSGKRKSSGKKMFGDLWKKKGQK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | SELPQRQSPRLRTSL CCCCCCCCCHHHHHH | 17.74 | 29654922 | |
41 | Phosphorylation | SRPITDRSPKLGLDR CCCCCCCCCCCCCCC | 29.24 | 25561503 | |
231 | Phosphorylation | KLKKKLESVEEAKET HHHHHHHHHHHHHHH | 45.31 | 24894044 | |
292 | Phosphorylation | FAGRFVGSPGMADDS CCCCCCCCCCCCCCC | 16.99 | 30291188 | |
299 | Phosphorylation | SPGMADDSDDGSGKR CCCCCCCCCCCCCCC | 37.84 | 23776212 | |
303 | Phosphorylation | ADDSDDGSGKRKSSG CCCCCCCCCCCCCCC | 48.40 | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ICR4_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ICR4_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ICR4_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KN13A_ARATH | KINESIN-13A | physical | 20832900 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...