UniProt ID | RIC5_ARATH | |
---|---|---|
UniProt AC | F4J424 | |
Protein Name | CRIB domain-containing protein RIC5 | |
Gene Name | RIC5 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 193 | |
Subcellular Localization |
Cell membrane Peripheral membrane protein . |
|
Protein Description | Functions as downstream effector of Rho-related GTP binding proteins of the "Rho of Plants" (ROPs) family. Participates in the propagation of ROP GTPase signals in specific cellular responses. Is involved in pollen tube growth regulation through its interaction with ARAC11/ROP1.. | |
Protein Sequence | MTSPMKGLLKGLRYIARIFEDEKEPEMQIGIPTDVKHVAHIGWEGPSATTPSWMHDFKPTDQTKTETKGTSNKKPGSSGEKHRKGRRKTSTGNNSPTESPSRVGGSVRPSKRNTGKQREQNTGSGSESGSGLELPQQTDQFVVPKQSKQKKSKGSATGGGEPPPSNEPSNKKETDISVRAVYPCAGLGSSTGR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
77 | Phosphorylation | TSNKKPGSSGEKHRK CCCCCCCCCCCCCCC | 19376835 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RIC5_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RIC5_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RIC5_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RIC5_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...