RIC5_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RIC5_ARATH
• UniProt AC: F4J424
• Protein Name: CRIB domain-containing protein RIC5
• Gene Name: RIC5
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 193
• Subcellular Localization: Cell membrane ; Peripheral membrane protein .
• Protein Description: Functions as downstream effector of Rho-related GTP binding proteins of the "Rho of Plants" (ROPs) family. Participates in the propagation of ROP GTPase signals in specific cellular responses. Is involved in pollen tube growth regulation through its interaction with ARAC11/ROP1..
• Protein Sequence: MTSPMKGLLKGLRYIARIFEDEKEPEMQIGIPTDVKHVAHIGWEGPSATTPSWMHDFKPTDQTKTETKGTSNKKPGSSGEKHRKGRRKTSTGNNSPTESPSRVGGSVRPSKRNTGKQREQNTGSGSESGSGLELPQQTDQFVVPKQSKQKKSKGSATGGGEPPPSNEPSNKKETDISVRAVYPCAGLGSSTGR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
77	Phosphorylation	TSNKKPGSSGEKHRK CCCCCCCCCCCCCCC		19376835

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RIC5_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RIC5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RIC5_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RIC5_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.