dbPTM

RIC6_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RIC6_ARATH
UniProt AC	Q1PF35
Protein Name	CRIB domain-containing protein RIC6
Gene Name	RIC6
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	212
Subcellular Localization	Cell membrane Peripheral membrane protein .
Protein Description	Functions as downstream effector of Rho-related GTP binding proteins of the "Rho of Plants" (ROPs) family. Participates in the propagation of ROP GTPase signals in specific cellular responses. Is involved in pollen tube growth regulation through its interaction with ARAC11/ROP1..
Protein Sequence	MQLTMSSSKMKSLLKGLRYISQVFESEKEEEIQIGNPTDVKHVAHIGWDGPSANATAPSWMTEFNSGGGFESAEGVGEDDSSIKCMSEYGGRSRDLPNLPKSTRKAASEKGSPTKDKSSDKTKRRSSNKGTSSSSRRPKEATEEQDELSSWPSGLPEIPKKSRRKKKSTKETAVNGGSSRSTRRSDVDNMSEYMSETGSVRSMPQFDNRDDF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of RIC6_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RIC6_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RIC6_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RIC6_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RIC6_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RIC6_ARATH

Related Literatures of Post-Translational Modification