| UniProt ID | PPE1_SCHPO | |
|---|---|---|
| UniProt AC | P36614 | |
| Protein Name | Serine/threonine-protein phosphatase ppe1 | |
| Gene Name | ppe1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 305 | |
| Subcellular Localization | Nucleus . Associated with chromatin. | |
| Protein Description | Has a role in chromosome segregation. May provide a dynamic connection between kinetochore microtubules and kinetochore chromatin. Negatively regulates mis12.. | |
| Protein Sequence | MFDLDEWIATVRKCKYLPEHQLKRLCEMVKVILMEESNIQPVRTPVTVCGDIHGQFYDLLELFRVGGELPSTNYIFMGDFVDRGYFSLETFTLFMLLKARYPDKITLLRGNHESRQITQVYGFYDECQTKYGNANVWKYCCQVFDFLTLAAVIDNKILCVHGGLSPEVRTLDQIRILARAQEIPHEGSFCDLMWSDPEDIESWTVSPRGAGWLFGSKVTTEFSQINDLTLIARAHQLVQEGYKYHFADKNLVTVWSAPNYCYRCGNVASVMKVDESLEPEFRIFSAVADEDRTVPPSRKRSEYFI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 188 | Phosphorylation | QEIPHEGSFCDLMWS HCCCCCCCCCHHCCC | 21.51 | 27738172 | |
| 276 | Phosphorylation | SVMKVDESLEPEFRI EEEECCCCCCCCEEE | 33.30 | 25720772 | |
| 301 | Phosphorylation | VPPSRKRSEYFI--- CCCCCCCCCCCC--- | 39.42 | 25720772 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPE1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPE1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPE1_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GSK3_SCHPO | gsk3 | genetic | 12773390 | |
| PP2A2_SCHPO | ppa2 | genetic | 8387356 | |
| PCK1_SCHPO | pck1 | genetic | 8387356 | |
| EKC1_SCHPO | ekc1 | physical | 12773390 | |
| PP2A1_SCHPO | ppa1 | genetic | 8387356 | |
| DIS3_SCHPO | dis3 | genetic | 8387356 | |
| MAG1_SCHPO | mag1 | genetic | 22681890 | |
| YAOE_SCHPO | SPAC11D3.14c | genetic | 22681890 | |
| KU80_SCHPO | pku80 | genetic | 22681890 | |
| MGR2_SCHPO | mgr2 | genetic | 22681890 | |
| GOS1_SCHPO | gos1 | genetic | 22681890 | |
| YGRG_SCHPO | SPBC365.16 | genetic | 22681890 | |
| MAC1_SCHPO | mac1 | genetic | 22681890 | |
| CAM2_SCHPO | cam2 | genetic | 22681890 | |
| ATP12_SCHPO | atp12 | genetic | 22681890 | |
| PNK1_SCHPO | pnk1 | genetic | 22681890 | |
| APQ12_SCHPO | apq12 | genetic | 22681890 | |
| VPS3_SCHPO | vps3 | genetic | 22681890 | |
| RM01_SCHPO | SPAC1610.02c | genetic | 22681890 | |
| CYSK_SCHPO | cys11 | genetic | 22681890 | |
| ATP11_SCHPO | atp11 | genetic | 22681890 | |
| TOM70_SCHPO | tom70 | genetic | 22681890 | |
| EMC1_SCHPO | emc1 | genetic | 22681890 | |
| YFE6_SCHPO | gmh5 | genetic | 22681890 | |
| RF1M_SCHPO | mrf1 | genetic | 22681890 | |
| EKC1_SCHPO | ekc1 | physical | 26771498 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...