UniProt ID | PPE1_SCHPO | |
---|---|---|
UniProt AC | P36614 | |
Protein Name | Serine/threonine-protein phosphatase ppe1 | |
Gene Name | ppe1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 305 | |
Subcellular Localization | Nucleus . Associated with chromatin. | |
Protein Description | Has a role in chromosome segregation. May provide a dynamic connection between kinetochore microtubules and kinetochore chromatin. Negatively regulates mis12.. | |
Protein Sequence | MFDLDEWIATVRKCKYLPEHQLKRLCEMVKVILMEESNIQPVRTPVTVCGDIHGQFYDLLELFRVGGELPSTNYIFMGDFVDRGYFSLETFTLFMLLKARYPDKITLLRGNHESRQITQVYGFYDECQTKYGNANVWKYCCQVFDFLTLAAVIDNKILCVHGGLSPEVRTLDQIRILARAQEIPHEGSFCDLMWSDPEDIESWTVSPRGAGWLFGSKVTTEFSQINDLTLIARAHQLVQEGYKYHFADKNLVTVWSAPNYCYRCGNVASVMKVDESLEPEFRIFSAVADEDRTVPPSRKRSEYFI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
188 | Phosphorylation | QEIPHEGSFCDLMWS HCCCCCCCCCHHCCC | 21.51 | 27738172 | |
276 | Phosphorylation | SVMKVDESLEPEFRI EEEECCCCCCCCEEE | 33.30 | 25720772 | |
301 | Phosphorylation | VPPSRKRSEYFI--- CCCCCCCCCCCC--- | 39.42 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPE1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPE1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPE1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GSK3_SCHPO | gsk3 | genetic | 12773390 | |
PP2A2_SCHPO | ppa2 | genetic | 8387356 | |
PCK1_SCHPO | pck1 | genetic | 8387356 | |
EKC1_SCHPO | ekc1 | physical | 12773390 | |
PP2A1_SCHPO | ppa1 | genetic | 8387356 | |
DIS3_SCHPO | dis3 | genetic | 8387356 | |
MAG1_SCHPO | mag1 | genetic | 22681890 | |
YAOE_SCHPO | SPAC11D3.14c | genetic | 22681890 | |
KU80_SCHPO | pku80 | genetic | 22681890 | |
MGR2_SCHPO | mgr2 | genetic | 22681890 | |
GOS1_SCHPO | gos1 | genetic | 22681890 | |
YGRG_SCHPO | SPBC365.16 | genetic | 22681890 | |
MAC1_SCHPO | mac1 | genetic | 22681890 | |
CAM2_SCHPO | cam2 | genetic | 22681890 | |
ATP12_SCHPO | atp12 | genetic | 22681890 | |
PNK1_SCHPO | pnk1 | genetic | 22681890 | |
APQ12_SCHPO | apq12 | genetic | 22681890 | |
VPS3_SCHPO | vps3 | genetic | 22681890 | |
RM01_SCHPO | SPAC1610.02c | genetic | 22681890 | |
CYSK_SCHPO | cys11 | genetic | 22681890 | |
ATP11_SCHPO | atp11 | genetic | 22681890 | |
TOM70_SCHPO | tom70 | genetic | 22681890 | |
EMC1_SCHPO | emc1 | genetic | 22681890 | |
YFE6_SCHPO | gmh5 | genetic | 22681890 | |
RF1M_SCHPO | mrf1 | genetic | 22681890 | |
EKC1_SCHPO | ekc1 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...